Recombinant Human KITLG Protein, GMP Grade, Animal-Free
Cat.No. : | KITLG-40HG |
Product Overview : | GMP Recombinant Human KITLG protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | SCF is a hematopoietic growth factor that exerts its activity by signaling through the c-Kit receptor. SCF and c-Kit are essential for the survival, proliferation and differentiation of hematopoietic cells committed to the melanocyte and germ cell lineages. Human SCF manifests low activity on murine cells, while murine and rat SCF are fully active on human cells. The human SCF gene encodes for a 273 amino acid transmembrane protein, which contains a 25 amino acid N-terminal signal sequence, a 189 amino acid extracellular domain, a 23 amino acid transmembrane domain, and a 36 amino acid cytoplasmic domain. The secreted soluble form of SCF is generated by proteolytic processing of the membrane anchored precursor. |
AA Sequence : | MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA |
Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
Gene Name | KITLG KIT ligand [ Homo sapiens (human) ] |
Official Symbol | KITLG |
Synonyms | KITLG; KIT ligand; MGF; kit ligand; familial progressive hyperpigmentation 2; FPH2; Kitl; KL 1; mast cell growth factor; SCF; SF; steel factor; stem cell factor; c-Kit ligand; KL-1; SHEP7; kit-ligand; DKFZp686F2250; |
Gene ID | 4254 |
mRNA Refseq | NM_000899 |
Protein Refseq | NP_000890 |
MIM | 184745 |
UniProt ID | P21583 |
◆ Recombinant Proteins | ||
Kitl-576M | Active Recombinant Mouse Kitl protein, His-tagged | +Inquiry |
KITLG-522H | Active Recombinant Human KITLG Protein, His-tagged, Biotinylated | +Inquiry |
KITLG-4321B | Recombinant Bovine KITLG Protein | +Inquiry |
KITL-526M | Recombinant Mouse KITL Protein | +Inquiry |
Kitlg-34M | Active Recombinant Mouse Kitlg, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KITLG-571HCL | Recombinant Human KITLG cell lysate | +Inquiry |
KITLG-583MCL | Recombinant Mouse KITLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KITLG Products
Required fields are marked with *
My Review for All KITLG Products
Required fields are marked with *