| Species : |
Mouse |
| Protein Length : |
273 |
| Description : |
Enables cytokine activity and stem cell factor receptor binding activity. Acts upstream of or within several processes, including positive regulation of cell differentiation; positive regulation of cell population proliferation; and positive regulation of protein phosphorylation. Located in extracellular space and plasma membrane. Is integral component of membrane. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; integumental system; and sensory organ. Human ortholog(s) of this gene implicated in autosomal dominant nonsyndromic deafness 69 and familial progressive hyperpigmentation with or without hypopigmentation. Orthologous to human KITLG (KIT ligand). |
| Form : |
Lyophilized |
| AA Sequence : |
MKKTQTWIITCIYLQLLLFNPLVKTKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKAPEDSGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV |
| Purity : |
> 98% |
| Applications : |
WB; ELISA; FACS; FC |
| Stability : |
This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : |
At -20 centigrade. |
| Storage Buffer : |
PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : |
Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |