Recombinant Human LDHB, His-tagged

Cat.No. : LDHB-26865TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-334 of Human lactate dehydrogenase B with N terminal His tag; 354 amino acids, 36.6kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 334 amino acids
Description : This gene encodes an enzyme which catalyzes the reversible conversion of lactate and pyruvate, and NAD and NADH, in the glycolytic pathway. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on the X chromosome and on chromosome. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Conjugation : HIS
Molecular Weight : 36.600kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHH SSGLVPRGSHMATLKEKLIAPVAEEEATVP NNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
Sequence Similarities : Belongs to the LDH/MDH superfamily. LDH family.
Gene Name LDHB lactate dehydrogenase B [ Homo sapiens ]
Official Symbol LDHB
Synonyms LDHB; lactate dehydrogenase B; L-lactate dehydrogenase B chain;
Gene ID 3945
mRNA Refseq NM_001174097
Protein Refseq NP_001167568
MIM 150100
Uniprot ID P07195
Chromosome Location 12p12.2-p12.1
Pathway Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Glycolysis / Gluconeogenesis, organism-specific biosystem; Glycolysis / Gluconeogenesis, conserved biosystem; Glycolysis and Gluconeogenesis, organism-specific biosystem;
Function L-lactate dehydrogenase activity; NAD binding; identical protein binding; oxidoreductase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LDHB Products

Required fields are marked with *

My Review for All LDHB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon