Recombinant Human LDHB, His-tagged
Cat.No. : | LDHB-26865TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-334 of Human lactate dehydrogenase B with N terminal His tag; 354 amino acids, 36.6kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 334 amino acids |
Description : | This gene encodes an enzyme which catalyzes the reversible conversion of lactate and pyruvate, and NAD and NADH, in the glycolytic pathway. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on the X chromosome and on chromosome. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
Conjugation : | HIS |
Molecular Weight : | 36.600kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHH SSGLVPRGSHMATLKEKLIAPVAEEEATVP NNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL |
Sequence Similarities : | Belongs to the LDH/MDH superfamily. LDH family. |
Gene Name | LDHB lactate dehydrogenase B [ Homo sapiens ] |
Official Symbol | LDHB |
Synonyms | LDHB; lactate dehydrogenase B; L-lactate dehydrogenase B chain; |
Gene ID | 3945 |
mRNA Refseq | NM_001174097 |
Protein Refseq | NP_001167568 |
MIM | 150100 |
Uniprot ID | P07195 |
Chromosome Location | 12p12.2-p12.1 |
Pathway | Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Glycolysis / Gluconeogenesis, organism-specific biosystem; Glycolysis / Gluconeogenesis, conserved biosystem; Glycolysis and Gluconeogenesis, organism-specific biosystem; |
Function | L-lactate dehydrogenase activity; NAD binding; identical protein binding; oxidoreductase activity; |
◆ Recombinant Proteins | ||
LDHB-4430H | Recombinant Human LDHB Protein (Met1-Leu334), His tagged | +Inquiry |
Ldhb-1818R | Recombinant Rat Ldhb protein, His-tagged | +Inquiry |
LDHB-3026R | Recombinant Rat LDHB Protein, His (Fc)-Avi-tagged | +Inquiry |
LDHB-82C | Recombinant Chicken Lactate Dehydrogenase B | +Inquiry |
Ldhb-1817M | Recombinant Mouse Ldhb protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LDH2-20H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
LDH2-8340H | Native Human LDH2 | +Inquiry |
LDH2-19H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
LDH2-220H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
LDH2-123H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDHB-4788HCL | Recombinant Human LDHB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LDHB Products
Required fields are marked with *
My Review for All LDHB Products
Required fields are marked with *
0
Inquiry Basket