Species : |
Human |
Source : |
E.coli |
Description : |
Galectin-3 belongs to the lectin family of carbohydrate binding proteins. Galectin-3 is expressed by a wide range of cell types including activated T cells, tumor cells, macrophages, osteoclasts, fibroblasts, and epithelial cells. Galectin-3 has specific binding affinity for beta-galactoside sugar moieties and has functional roles during development, innate immunity, cell apoptosis, and tumor metastasis. Galectin-3 is associated with cancer, heart failure, stroke, and inflammation. The amino acid sequences of human and mouse Galectin-3 proteins share 80% homology. |
Bio-activity : |
No biological activity data is available at this time. |
Molecular Mass : |
Monomer, 26.2 kDa (250 aa) |
AA Sequence : |
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI |
Endotoxin : |
≤1 EUs/μg, Kinetic LAL |
Purity : |
≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : |
12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : |
Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : |
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5 |
Reconstitution : |
Sterile water at 0.1 mg/mL |
Shipping : |
Room temperature |
Instructions : |
Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |