Recombinant Human LIF Protein, GMP Grade, Animal-Free

Cat.No. : LIF-38HG
Product Overview : GMP Recombinant Human LIF protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 180 amino acids residues, including three disulfide bonds
Description : LIF is a pleiotrophic factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. While human LIF is active on mouse cells, mouse LIF is not active on human cells due to its inability to bind to the human LIF receptor.
Molecular Mass : 19.7 kDa
AA Sequence : SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Purity : ≥ 98% by SDS-PAGE gel and HPLC analyses.
Gene Name LIF leukemia inhibitory factor [ Homo sapiens (human) ]
Official Symbol LIF
Synonyms LIF; leukemia inhibitory factor; CDF; cholinergic differentiation factor; DIA; differentiation inhibitory activity; differentiation inducing factor; hepatocyte stimulating factor III; HILDA; human interleukin in DA cells; D factor; melanoma-derived LPL inhibitor; differentiation-inducing factor; hepatocyte-stimulating factor III; differentiation-stimulating factor; MLPLI;
Gene ID 3976
mRNA Refseq NM_001257135
Protein Refseq NP_001244064
MIM 159540
UniProt ID P15018

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LIF Products

Required fields are marked with *

My Review for All LIF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon