Recombinant Human LIF Protein, GMP Grade, Animal-Free
Cat.No. : | LIF-38HG |
Product Overview : | GMP Recombinant Human LIF protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 180 amino acids residues, including three disulfide bonds |
Description : | LIF is a pleiotrophic factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. While human LIF is active on mouse cells, mouse LIF is not active on human cells due to its inability to bind to the human LIF receptor. |
Molecular Mass : | 19.7 kDa |
AA Sequence : | SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF |
Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
Gene Name | LIF leukemia inhibitory factor [ Homo sapiens (human) ] |
Official Symbol | LIF |
Synonyms | LIF; leukemia inhibitory factor; CDF; cholinergic differentiation factor; DIA; differentiation inhibitory activity; differentiation inducing factor; hepatocyte stimulating factor III; HILDA; human interleukin in DA cells; D factor; melanoma-derived LPL inhibitor; differentiation-inducing factor; hepatocyte-stimulating factor III; differentiation-stimulating factor; MLPLI; |
Gene ID | 3976 |
mRNA Refseq | NM_001257135 |
Protein Refseq | NP_001244064 |
MIM | 159540 |
UniProt ID | P15018 |
◆ Recombinant Proteins | ||
LIF-02H | Recombinant Human LIF Protein, His-tagged | +Inquiry |
LIF-527H | Recombinant Human LIF Protein, MYC/DDK-tagged | +Inquiry |
Lif-043L | Active Recombinant Mouse Lif Protein (181 aa) | +Inquiry |
LIF-26H | Recombinant Human LIF Protein | +Inquiry |
LIF-1398H | Recombinant Human LIF protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIF-1729MCL | Recombinant Mouse LIF cell lysate | +Inquiry |
LIF-1071HCL | Recombinant Human LIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LIF Products
Required fields are marked with *
My Review for All LIF Products
Required fields are marked with *
0
Inquiry Basket