Recombinant Human LIF Protein, His-tagged
| Cat.No. : | LIF-02H |
| Product Overview : | Recombinant Human LIF Protein, fused to His-tag was expressed in HEK293T cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Description : | The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Form : | Liquid |
| AA Sequence : | SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAFGGGGSHHHHHH* |
| Purity : | >90% determined by SDS-PAGE (Reduced). |
| Storage : | Store at -20 centigrade to -80 centigrade. |
| Storage Buffer : | PBS, pH 6.8 |
| Gene Name | LIF LIF interleukin 6 family cytokine [ Homo sapiens (human) ] |
| Official Symbol | LIF |
| Synonyms | CDF; DIA; HILDA; MLPLI |
| Gene ID | 3976 |
| mRNA Refseq | NM_002309.5 |
| Protein Refseq | NP_002300.1 |
| MIM | 159540 |
| UniProt ID | P15018 |
| ◆ Recombinant Proteins | ||
| LIF-8868H | Active Recombinant Human LIF, His-tagged | +Inquiry |
| LIF-519H | Recombinant Human LIF Protein | +Inquiry |
| Lif-33M | Active Recombinant Mouse Lif Protein (Ready-to-Use, 181 amino acid) | +Inquiry |
| LIF-2623H | Active Recombinant Human LIF protein, His-tagged | +Inquiry |
| Lif-122M | Recombinant Mouse Lif Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LIF-1071HCL | Recombinant Human LIF cell lysate | +Inquiry |
| LIF-1729MCL | Recombinant Mouse LIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIF Products
Required fields are marked with *
My Review for All LIF Products
Required fields are marked with *
