Recombinant Human LIF Protein, His-tagged
Cat.No. : | LIF-02H |
Product Overview : | Recombinant Human LIF Protein, fused to His-tag was expressed in HEK293T cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Form : | Liquid |
AA Sequence : | SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAFGGGGSHHHHHH* |
Purity : | >90% determined by SDS-PAGE (Reduced). |
Storage : | Store at -20 centigrade to -80 centigrade. |
Storage Buffer : | PBS, pH 6.8 |
Gene Name | LIF LIF interleukin 6 family cytokine [ Homo sapiens (human) ] |
Official Symbol | LIF |
Synonyms | CDF; DIA; HILDA; MLPLI |
Gene ID | 3976 |
mRNA Refseq | NM_002309.5 |
Protein Refseq | NP_002300.1 |
MIM | 159540 |
UniProt ID | P15018 |
◆ Recombinant Proteins | ||
LIF-1398H | Recombinant Human LIF protein | +Inquiry |
LIF-167H | Active Recombinant Human LIF Protein, Biotinylated | +Inquiry |
Lif-757M | Active Recombinant Mouse Lif protein, His-tagged | +Inquiry |
LIF-02H | Recombinant Human LIF Protein, His-tagged | +Inquiry |
LIF-472H | Recombinant Human LIF, His-GST | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIF-1071HCL | Recombinant Human LIF cell lysate | +Inquiry |
LIF-1729MCL | Recombinant Mouse LIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIF Products
Required fields are marked with *
My Review for All LIF Products
Required fields are marked with *