Recombinant Human LUM Protein, His-tagged
Cat.No. : | LUM-822H |
Product Overview : | Recombinant human LUM protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly charged hydrophilic glycosaminoglycans regulate interfibrillar spacings. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair. |
Form : | Lyophilized |
Molecular Mass : | 37.5 kDa |
AA Sequence : | MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN |
Purity : | > 98% |
Applications : | Migration Assay; ELISA; FACS; FC; |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | LUM lumican [ Homo sapiens (human) ] |
Official Symbol | LUM |
Synonyms | LUM; lumican; LDC; lumican proteoglycan; SLRR2D; KSPG lumican; keratan sulfate proteoglycan lumican; |
Gene ID | 4060 |
mRNA Refseq | NM_002345 |
Protein Refseq | NP_002336 |
MIM | 600616 |
UniProt ID | P51884 |
◆ Recombinant Proteins | ||
LUM-1936R | Recombinant Rat LUM Protein (19-338 aa), His-tagged | +Inquiry |
LUM-1220H | Recombinant Human LUM Protein, MYC/DDK-tagged | +Inquiry |
LUM-2593R | Recombinant Rhesus monkey LUM Protein, His-tagged | +Inquiry |
LUM-154H | Recombinant Human LUM protein, His-tagged | +Inquiry |
LUM-3504R | Recombinant Rat LUM Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LUM-2210HCL | Recombinant Human LUM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LUM Products
Required fields are marked with *
My Review for All LUM Products
Required fields are marked with *
0
Inquiry Basket