Recombinant Mouse Lum protein, His&Myc-tagged
Cat.No. : | Lum-3188M |
Product Overview : | Recombinant Mouse Lum protein(P51885)(19-338aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 19-338aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.0 kDa |
AA Sequence : | QYYDYDIPLFMYGQISPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLTNNKISKLGSFDGLVNLTFIYLQHNQLKEDAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKISNIPDEYFKRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNELEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Lum lumican [ Mus musculus ] |
Official Symbol | Lum |
Synonyms | LUM; lumican; KSPG lumican; keratan sulfate proteoglycan lumican; Ldc; SLRR2D; |
Gene ID | 17022 |
mRNA Refseq | NM_008524 |
Protein Refseq | NP_032550 |
◆ Recombinant Proteins | ||
LUM-9360M | Recombinant Mouse LUM Protein | +Inquiry |
Lum-3188M | Recombinant Mouse Lum protein, His&Myc-tagged | +Inquiry |
LUM-2593R | Recombinant Rhesus monkey LUM Protein, His-tagged | +Inquiry |
Lum-5035R | Recombinant Rat Lum protein, His-tagged | +Inquiry |
LUM-3223H | Recombinant Human LUM, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LUM-2210HCL | Recombinant Human LUM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lum Products
Required fields are marked with *
My Review for All Lum Products
Required fields are marked with *
0
Inquiry Basket