Recombinant Human LUM
Cat.No. : | LUM-29148TH |
Product Overview : | Recombinant full length Human Lumican with a N terminal proprietary tag: Predicted molecular weight 63.25 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 338 amino acids |
Description : | This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly charged hydrophilic glycosaminoglycans regulate interfibrillar spacings. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair. |
Molecular Weight : | 63.250kDa inclusive of tags |
Tissue specificity : | Cornea and other tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPE CNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDH IDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKK LHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVN LTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLP SGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNE LADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYY LEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETS LPPDMYECLRVANEVTLN |
Sequence Similarities : | Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class II subfamily.Contains 11 LRR (leucine-rich) repeats.Contains 1 LRRNT domain. |
Gene Name | LUM lumican [ Homo sapiens ] |
Official Symbol | LUM |
Synonyms | LUM; lumican; LDC; lumican proteoglycan; SLRR2D; |
Gene ID | 4060 |
mRNA Refseq | NM_002345 |
Protein Refseq | NP_002336 |
MIM | 600616 |
Uniprot ID | P51884 |
Chromosome Location | 12q21.3-q22 |
Function | collagen binding; extracellular matrix structural constituent; |
◆ Recombinant Proteins | ||
Lum-3188M | Recombinant Mouse Lum protein, His&Myc-tagged | +Inquiry |
LUM-1220H | Recombinant Human LUM Protein, MYC/DDK-tagged | +Inquiry |
LUM-2593R | Recombinant Rhesus monkey LUM Protein, His-tagged | +Inquiry |
LUM-293Z | Recombinant Zebrafish LUM | +Inquiry |
LUM-3160R | Recombinant Rat LUM Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LUM-2210HCL | Recombinant Human LUM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LUM Products
Required fields are marked with *
My Review for All LUM Products
Required fields are marked with *
0
Inquiry Basket