Recombinant Human MDH1, His-tagged

Cat.No. : MDH1-29754TH
Product Overview : Recombinant full length Human MDH1 with an C terminal His tag; 342 amino acids including tag, predicted MWt 37.4kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 334 amino acids
Description : Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Conjugation : HIS
Molecular Weight : 37.400kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSALEHHHHHH
Gene Name MDH1 malate dehydrogenase 1, NAD (soluble) [ Homo sapiens ]
Official Symbol MDH1
Synonyms MDH1; malate dehydrogenase 1, NAD (soluble); malate dehydrogenase, cytoplasmic;
Gene ID 4190
mRNA Refseq NM_001199111
Protein Refseq NP_001186040
MIM 154200
Uniprot ID P40925
Chromosome Location 2p23
Pathway Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate, organism-specific biosystem; Citrate cycle, second carbon oxidation, 2-oxoglutarate =>
Function L-malate dehydrogenase activity; NAD binding; malic enzyme activity; oxidoreductase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MDH1 Products

Required fields are marked with *

My Review for All MDH1 Products

Required fields are marked with *

0
cart-icon