Recombinant Human MICA

Cat.No. : MICA-30099TH
Product Overview : Recombinant full length mature protein, a single, non-glycosylated polypeptide chain of 320 amino acids containing the extracellular amino acids 24-306 of Human MICA, 36kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 283 amino acids
Description : MICA encodes the higly polymorphic MHC (HLA) class I chain-related gene A. The protein product is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Alternative splicing results in multiple transcript variants.
Tissue specificity : Widely expressed with the exception of the central nervous system where it is absent. Expressed predominantly in gastric epithelium and also in monocytes, keratinocytes, endothelial cells, fibroblasts and in the outer layer of Hassals corpuscles within th
Form : Lyophilised:Lyophilized from a concentrated (1mg/ml) solution, reconstitute the lyophilized MICA in sterile 18MO-cm water not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Purity : >95% by SDS-PAGE
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQK CRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLA HIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGEL FLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTK THYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSE ASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGD VLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTH PVPSGKVLVLQSH.
Sequence Similarities : Belongs to the MHC class I family. MIC subfamily.Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
Gene Name MICA MHC class I polypeptide-related sequence A [ Homo sapiens ]
Official Symbol MICA
Synonyms MICA; MHC class I polypeptide-related sequence A; PERB11.1;
Gene ID 4276
mRNA Refseq NM_000247
Protein Refseq NP_000238
MIM 600169
Uniprot ID Q29983
Chromosome Location 6p21.3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MICA Products

Required fields are marked with *

My Review for All MICA Products

Required fields are marked with *

0
cart-icon