"MTHFD2L" Related Products

Expand
Expand

Recombinant Human MTHFD2L Protein, GST-tagged

Cat.No. : MTHFD2L-5705H
Product Overview : Human MTHFD2L full-length ORF ( AAH32771.1, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal.
Description : MTHFD2L (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2 Like) is a Protein Coding gene. Among its related pathways are Metabolism and One carbon pool by folate. GO annotations related to this gene include formate-tetrahydrofolate ligase activity and methylenetetrahydrofolate dehydrogenase (NADP+) activity. An important paralog of this gene is MTHFD2.
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 42.4 kDa
AA Sequence : MDPRVSGILVQLPLPDHVDERTICNGIAPEKDVDGFHIINIGRLCLDQHSLIPATASAVWEIIKRTGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTPKEQLKIHTQLADIIIVAAERFHHFAQDLSNS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing: :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : MTHFD2L methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like [ Homo sapiens ]
Official Symbol : MTHFD2L
Synonyms : MTHFD2L; methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like; probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2; MGC72244; MTHFD2-like; NADP-dependent methylenetetrahydrofolate dehydrogenase 2-like protein; FLJ13105; MGC45532;
Gene ID : 441024
mRNA Refseq : NM_001144978
Protein Refseq : NP_001138450
MIM : 614047
UniProt ID : Q9H903

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.