Recombinant Full Length Human MTHFD2L Protein, GST-tagged

Cat.No. : MTHFD2L-6529HF
Product Overview : Human MTHFD2L full-length ORF ( AAH32771.1, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 146 amino acids
Description : MTHFD2L (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2 Like) is a Protein Coding gene. Among its related pathways are Metabolism and One carbon pool by folate. GO annotations related to this gene include formate-tetrahydrofolate ligase activity and methylenetetrahydrofolate dehydrogenase (NADP+) activity. An important paralog of this gene is MTHFD2.
Molecular Mass : 42.4 kDa
AA Sequence : MDPRVSGILVQLPLPDHVDERTICNGIAPEKDVDGFHIINIGRLCLDQHSLIPATASAVWEIIKRTGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTPKEQLKIHTQLADIIIVAAERFHHFAQDLSNS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MTHFD2L methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like [ Homo sapiens ]
Official Symbol MTHFD2L
Synonyms MTHFD2L; methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like; probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2; MGC72244; MTHFD2-like; NADP-dependent methylenetetrahydrofolate dehydrogenase 2-like protein; FLJ13105; MGC45532;
Gene ID 441024
mRNA Refseq NM_001144978
Protein Refseq NP_001138450
MIM 614047
UniProt ID Q9H903

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTHFD2L Products

Required fields are marked with *

My Review for All MTHFD2L Products

Required fields are marked with *

0
cart-icon
0
compare icon