Recombinant Full Length Human MTHFD2L Protein, GST-tagged
| Cat.No. : | MTHFD2L-6529HF |
| Product Overview : | Human MTHFD2L full-length ORF ( AAH32771.1, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 146 amino acids |
| Description : | MTHFD2L (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2 Like) is a Protein Coding gene. Among its related pathways are Metabolism and One carbon pool by folate. GO annotations related to this gene include formate-tetrahydrofolate ligase activity and methylenetetrahydrofolate dehydrogenase (NADP+) activity. An important paralog of this gene is MTHFD2. |
| Molecular Mass : | 42.4 kDa |
| AA Sequence : | MDPRVSGILVQLPLPDHVDERTICNGIAPEKDVDGFHIINIGRLCLDQHSLIPATASAVWEIIKRTGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTPKEQLKIHTQLADIIIVAAERFHHFAQDLSNS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MTHFD2L methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like [ Homo sapiens ] |
| Official Symbol | MTHFD2L |
| Synonyms | MTHFD2L; methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like; probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2; MGC72244; MTHFD2-like; NADP-dependent methylenetetrahydrofolate dehydrogenase 2-like protein; FLJ13105; MGC45532; |
| Gene ID | 441024 |
| mRNA Refseq | NM_001144978 |
| Protein Refseq | NP_001138450 |
| MIM | 614047 |
| UniProt ID | Q9H903 |
| ◆ Recombinant Proteins | ||
| MTHFD2L-3810R | Recombinant Rat MTHFD2L Protein | +Inquiry |
| Mthfd2l-4211M | Recombinant Mouse Mthfd2l Protein, Myc/DDK-tagged | +Inquiry |
| MTHFD2L-5705H | Recombinant Human MTHFD2L Protein, GST-tagged | +Inquiry |
| MTHFD2L-10193M | Recombinant Mouse MTHFD2L Protein | +Inquiry |
| MTHFD2L-3469R | Recombinant Rat MTHFD2L Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTHFD2L Products
Required fields are marked with *
My Review for All MTHFD2L Products
Required fields are marked with *
