Recombinant Full Length Human MTHFD2L Protein, C-Flag-tagged
Cat.No. : | MTHFD2L-1160HFL |
Product Overview : | Recombinant Full Length Human MTHFD2L Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable methenyltetrahydrofolate cyclohydrolase activity; methylenetetrahydrofolate dehydrogenase (NAD+) activity; and methylenetetrahydrofolate dehydrogenase (NADP+) activity. Predicted to be involved in tetrahydrofolate interconversion. Predicted to be located in mitochondrial matrix. Predicted to be active in mitochondrion. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 37.1 kDa |
AA Sequence : | MTVPVRGFSLLRGRLGRAPALGRSTAPSVRAPGEPGSAFRGFRSSGVRHEAIIISGTEMAKHIQKEIQRG VESWVSLGNRRPHLSIILVGDNPASHTYVRNKIRAASAVGICSELILKPKDVSQEELLDVTDQLNMDPRV SGILVQLPLPDHVDERTICNGIAPEKDVDGFHIINIGRLCLDQHSLIPATASAVWEIIKRTGIQTFGKNV VVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTPKEQLKIHTQLADIIIVAAGIPKLITSDMVK EGAAVIDVGINYVHDPVTGKTKLVGDVDFEAVKKKAGFITPVPGGVGPMTVAMLLKNTLLAAKKIIYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | MTHFD2L methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2 like [ Homo sapiens (human) ] |
Official Symbol | MTHFD2L |
Synonyms | FLJ13105; MGC45532; MGC72244 |
Gene ID | 441024 |
mRNA Refseq | NM_001144978.3 |
Protein Refseq | NP_001138450.1 |
MIM | 614047 |
UniProt ID | Q9H903 |
◆ Recombinant Proteins | ||
MTHFD2L-5780M | Recombinant Mouse MTHFD2L Protein, His (Fc)-Avi-tagged | +Inquiry |
MTHFD2L-6710H | Recombinant Human MTHFD2L Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MTHFD2L-5705H | Recombinant Human MTHFD2L Protein, GST-tagged | +Inquiry |
MTHFD2L-2188H | Recombinant Human MTHFD2L Protein, MYC/DDK-tagged | +Inquiry |
Mthfd2l-4211M | Recombinant Mouse Mthfd2l Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTHFD2L Products
Required fields are marked with *
My Review for All MTHFD2L Products
Required fields are marked with *
0
Inquiry Basket