Recombinant Human NPC2 Protein, GST-tagged

Cat.No. : NPC2-6019H
Product Overview : Human NPC2 full-length ORF ( AAH02532, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy. [provided by RefSeq
Molecular Mass : 42.35 kDa
AA Sequence : MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NPC2 Niemann-Pick disease, type C2 [ Homo sapiens ]
Official Symbol NPC2
Synonyms NPC2; Niemann-Pick disease, type C2; epididymal secretory protein E1; EDDM1; epididymal protein 1; HE1; NP C2; tissue-specific secretory protein; human epididymis-specific protein 1; niemann-Pick disease type C2 protein; MGC1333;
Gene ID 10577
mRNA Refseq NM_006432
Protein Refseq NP_006423
MIM 601015
UniProt ID P61916

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPC2 Products

Required fields are marked with *

My Review for All NPC2 Products

Required fields are marked with *

0
cart-icon