Recombinant Dog NPC2 protein, His-SUMO-tagged
Cat.No. : | NPC2-4457D |
Product Overview : | Recombinant Dog NPC2 protein(Q28895)(22-149aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 22-149aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30 kDa |
AA Sequence : | VHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLGVAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYPSIKLVVQWMLLGDNNQHLFCWEIPVQIEG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | NPC2 Niemann-Pick disease, type C2 [ Canis lupus familiaris ] |
Official Symbol | NPC2 |
Synonyms | NPC2; Niemann-Pick disease, type C2; epididymal secretory protein E1; niemann Pick type C2 protein homolog; CE1; |
Gene ID | 403920 |
mRNA Refseq | NM_001003242 |
Protein Refseq | NP_001003242 |
◆ Recombinant Proteins | ||
NPC2-3913H | Recombinant Human NPC2 Protein (Glu20-Leu151), C-His tagged | +Inquiry |
NPC2-6019H | Recombinant Human NPC2 Protein, GST-tagged | +Inquiry |
NPC2-2897R | Recombinant Rhesus Macaque NPC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NPC2-6611HF | Recombinant Full Length Human NPC2 Protein, GST-tagged | +Inquiry |
NPC2-6153M | Recombinant Mouse NPC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPC2-001HCL | Recombinant Human NPC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPC2 Products
Required fields are marked with *
My Review for All NPC2 Products
Required fields are marked with *