Recombinant Full Length Human NPC2 Protein, GST-tagged
| Cat.No. : | NPC2-6611HF |
| Product Overview : | Human NPC2 full-length ORF ( AAH02532, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 151 amino acids |
| Description : | This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy. [provided by RefSeq |
| Molecular Mass : | 42.35 kDa |
| AA Sequence : | MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NPC2 Niemann-Pick disease, type C2 [ Homo sapiens ] |
| Official Symbol | NPC2 |
| Synonyms | NPC2; Niemann-Pick disease, type C2; epididymal secretory protein E1; EDDM1; epididymal protein 1; HE1; NP C2; tissue-specific secretory protein; human epididymis-specific protein 1; niemann-Pick disease type C2 protein; MGC1333; |
| Gene ID | 10577 |
| mRNA Refseq | NM_006432 |
| Protein Refseq | NP_006423 |
| MIM | 601015 |
| UniProt ID | P61916 |
| ◆ Recombinant Proteins | ||
| NPC2-3913H | Recombinant Human NPC2 Protein (Glu20-Leu151), C-His tagged | +Inquiry |
| NPC2-878M | Recombinant Mouse NPC2 Protein (Met1-Ser149), His-tagged | +Inquiry |
| NPC2-10811M | Recombinant Mouse NPC2 Protein | +Inquiry |
| NPC2-162H | Recombinant Human NPC2 protein, His-tagged | +Inquiry |
| NPC2-826H | Recombinant Human NPC2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NPC2-001HCL | Recombinant Human NPC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPC2 Products
Required fields are marked with *
My Review for All NPC2 Products
Required fields are marked with *
