Recombinant Human PDGFA Protein, GMP Grade, Animal-Free
Cat.No. : | PDGFA-39HG |
Product Overview : | GMP Recombinant Human PDGFA protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs, PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types, including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. |
AA Sequence : | SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT |
Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
Gene Name | PDGFA platelet-derived growth factor alpha polypeptide [ Homo sapiens (human) ] |
Official Symbol | PDGFA |
Synonyms | PDGFA; platelet-derived growth factor alpha polypeptide; platelet-derived growth factor subunit A; PDGF A chain; PDGF A; PDGF1; platelet derived growth factor alpha chain; PDGF-1; PDGF A-chain; PDGF subunit A; platelet-derived growth factor A chain; platelet-derived growth factor alpha chain; platelet-derived growth factor alpha isoform 2 preproprotein; PDGF-A; |
Gene ID | 5154 |
mRNA Refseq | NM_002607 |
Protein Refseq | NP_002598 |
MIM | 173430 |
UniProt ID | P04085 |
◆ Recombinant Proteins | ||
PDGFA-174H | Recombinant Human PDGFA protein, His/S-tagged | +Inquiry |
PDGFA-563H | Recombinant Human PDGFA Protein (Ser87-Thr211), His-tagged | +Inquiry |
PDGFA-375H | Active Recombinant Human Platelet-derived Growth Factor AA | +Inquiry |
PDGFA-101H | Active Recombinant Human PDGFA | +Inquiry |
Pdgfa-298M | Recombinant Mouse Platelet Derived Growth Factor AA | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFA-3337HCL | Recombinant Human PDGFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFA Products
Required fields are marked with *
My Review for All PDGFA Products
Required fields are marked with *