Recombinant Human PDGFA Protein, GMP Grade, Animal-Free

Cat.No. : PDGFA-39HG
Product Overview : GMP Recombinant Human PDGFA protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs, PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types, including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells.
AA Sequence : SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
Purity : ≥ 98% by SDS-PAGE gel and HPLC analyses.
Gene Name PDGFA platelet-derived growth factor alpha polypeptide [ Homo sapiens (human) ]
Official Symbol PDGFA
Synonyms PDGFA; platelet-derived growth factor alpha polypeptide; platelet-derived growth factor subunit A; PDGF A chain; PDGF A; PDGF1; platelet derived growth factor alpha chain; PDGF-1; PDGF A-chain; PDGF subunit A; platelet-derived growth factor A chain; platelet-derived growth factor alpha chain; platelet-derived growth factor alpha isoform 2 preproprotein; PDGF-A;
Gene ID 5154
mRNA Refseq NM_002607
Protein Refseq NP_002598
MIM 173430
UniProt ID P04085

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDGFA Products

Required fields are marked with *

My Review for All PDGFA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon