Recombinant Human Suppressor Of Cytokine Signaling 3, GST-tagged
Cat.No. : | SOCS3-6941H |
Product Overview : | RecombinantHuman SOCS3 protein wasexpressed as GST-tagged fusion protein by vitro wheatgerm. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | SOCS3is a protein that in humans is encoded by the SOCS3 gene. This gene encodes amember of the STAT-induced STAT inhibitor (SSI), also known as suppressor ofcytokine signaling (SOCS), family. SSI family members are cytokine-induciblenegative regulators of cytokine signaling. The expression of this gene isinduced by various cytokines, including IL6, IL10, and interferon(IFN)-gamma. The protein encoded by this gene can bind to JAK2 kinase, andinhibit the activity of JAK2 kinase. |
Quality ControlTesting : | 12.5%SDS-PAGE Stained with Coomassie Blue. |
Sequence : | MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL |
Preparation Method : | in vitro wheatgerm expression system |
Molecular Weight : | 50.49 kDa |
Purification : | GlutathioneSepharose 4 Fast Flow. |
Buffer : | 50 mMTris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage : | Storeat -80°C. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SOCS3 suppressor of cytokine signaling 3 [ Homosapiens ] |
Official Symbol | SOCS3 |
Synonyms | SOCS3;suppressor of cytokine signaling 3; CIS3; SSI3; ATOD4; Cish3;SSI-3; SOCS-3; MGC71791; CIS-3; STAT-induced STAT inhibitor 3; cytokine-inducedSH2 protein 3; cytokine-inducible SH2 protein 3 |
Gene ID | 9021 |
mRNA Refseq | NM_003955 |
Protein Refseq | NP_003946 |
MIM | 604176 |
UniProt ID | O14543 |
Chromosome Location | 17q25.3 |
Pathway | ATF-2 transcription factor network; Adipocytokinesignaling pathway; Class I MHC mediated antigen processing & presentation;Cytokine Signaling in Immune system; ECS complex; EGFR1 Signaling Pathway; EPOsignaling pathway; Growth hormone receptor signaling; Herpes simplexinfection; IL-2 Signaling Pathway; IL-3 Signaling Pathway; IL-4 SignalingPathway; IL-6 Signaling Pathway; IL-9 Signaling Pathway |
Function | protein kinase inhibitor activity |
◆ Recombinant Proteins | ||
SOCS3-4402R | Recombinant Rhesus monkey SOCS3 Protein, His-tagged | +Inquiry |
SOCS3-6168C | Recombinant Chicken SOCS3 | +Inquiry |
SOCS3-2068H | Recombinant Human SOCS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Socs3-3515R | Recombinant Rat Socs3 protein, His-SUMO-tagged | +Inquiry |
SOCS3-5324R | Recombinant Rat SOCS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOCS3-1580HCL | Recombinant Human SOCS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SOCS3 Products
Required fields are marked with *
My Review for All SOCS3 Products
Required fields are marked with *
0
Inquiry Basket