Recombinant Mouse Akr1b3 Protein, His-tagged

Cat.No. : Akr1b3-7161M
Product Overview : Recombinant mouse Akr1b1, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-316
Description : Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols with a broad range of catalytic efficiencies.
Form : Liquid
Molecular Mass : 38.1 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSMASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDLGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDKSMVKGAFQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKTIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPVRIAENLKVFDFEVSSEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV
Purity : > 95 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by Bradford assay)
Storage Buffer : Phosphate buffer saline (pH 7.4) containing 10 % glycerol.
Gene Name Akr1b3 aldo-keto reductase family 1, member B3 (aldose reductase) [ Mus musculus (house mouse) ]
Official Symbol Akr1b3
Synonyms Akr1b3; aldo-keto reductase family 1, member B3 (aldose reductase); A; AR; Ah; Al; Ahr; ALR2; Ahr1; Ahr-1; Aldr1; Akr1b1; Aldor1; aldo-keto reductase family 1 member B1; aldehyde reductase 1; aldo-keto reductase family 1 member B3; aldo-keto reductase family 1, member B1 (aldose reductase); aldose reductase; EC 1.1.1.21; EC 1.1.1.300; EC 1.1.1.372; EC 1.1.1.54
Gene ID 11677
mRNA Refseq NM_009658
Protein Refseq NP_033788
UniProt ID P45376

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Akr1b3 Products

Required fields are marked with *

My Review for All Akr1b3 Products

Required fields are marked with *

0
cart-icon