Recombinant Mouse Akr1b3 Protein, His-tagged

• Cat.No.: Akr1b3-7161M
• Product Overview: Recombinant mouse Akr1b1, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-316
• Description: Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols with a broad range of catalytic efficiencies.
• Form: Liquid
• Molecular Mass: 38.1 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSMASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDLGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDKSMVKGAFQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKTIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPVRIAENLKVFDFEVSSEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by Bradford assay)
• Storage Buffer: Phosphate buffer saline (pH 7.4) containing 10 % glycerol.

Gene Information

• Gene Name: Akr1b3 aldo-keto reductase family 1, member B3 (aldose reductase) [ Mus musculus (house mouse) ]
• Official Symbol: Akr1b3
• Synonyms: Akr1b3; aldo-keto reductase family 1, member B3 (aldose reductase); A; AR; Ah; Al; Ahr; ALR2; Ahr1; Ahr-1; Aldr1; Akr1b1; Aldor1; aldo-keto reductase family 1 member B1; aldehyde reductase 1; aldo-keto reductase family 1 member B3; aldo-keto reductase family 1, member B1 (aldose reductase); aldose reductase; EC 1.1.1.21; EC 1.1.1.300; EC 1.1.1.372; EC 1.1.1.54
• Gene ID: 11677
• mRNA Refseq: NM_009658
• Protein Refseq: NP_033788
• UniProt ID: P45376