Recombinant Mouse Akr1b3 Protein, His-tagged
Cat.No. : | Akr1b3-7161M |
Product Overview : | Recombinant mouse Akr1b1, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-316 |
Description : | Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols with a broad range of catalytic efficiencies. |
Form : | Liquid |
Molecular Mass : | 38.1 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDLGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDKSMVKGAFQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKTIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPVRIAENLKVFDFEVSSEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by Bradford assay) |
Storage Buffer : | Phosphate buffer saline (pH 7.4) containing 10 % glycerol. |
Gene Name | Akr1b3 aldo-keto reductase family 1, member B3 (aldose reductase) [ Mus musculus (house mouse) ] |
Official Symbol | Akr1b3 |
Synonyms | Akr1b3; aldo-keto reductase family 1, member B3 (aldose reductase); A; AR; Ah; Al; Ahr; ALR2; Ahr1; Ahr-1; Aldr1; Akr1b1; Aldor1; aldo-keto reductase family 1 member B1; aldehyde reductase 1; aldo-keto reductase family 1 member B3; aldo-keto reductase family 1, member B1 (aldose reductase); aldose reductase; EC 1.1.1.21; EC 1.1.1.300; EC 1.1.1.372; EC 1.1.1.54 |
Gene ID | 11677 |
mRNA Refseq | NM_009658 |
Protein Refseq | NP_033788 |
UniProt ID | P45376 |
◆ Recombinant Proteins | ||
AKR1B3-435M | Recombinant Mouse AKR1B3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Akr1b3-3268M | Recombinant Mouse Akr1b3, His-tagged | +Inquiry |
Akr1b3-576M | Recombinant Mouse Akr1b3 Protein, MYC/DDK-tagged | +Inquiry |
Akr1b3-7161M | Recombinant Mouse Akr1b3 Protein, His-tagged | +Inquiry |
AKR1B3-1492M | Recombinant Mouse AKR1B3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Akr1b3 Products
Required fields are marked with *
My Review for All Akr1b3 Products
Required fields are marked with *
0
Inquiry Basket