Active Recombinant Mouse Ccl22 Protein
Cat.No. : | Ccl22-131M |
Product Overview : | Purified recombinant protein of Mouse chemokine (C-C motif) ligand 22 (Ccl22) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Chemotactic for activated T-lymphocytes. May play an important role in the collaboration of dendritic cells and B-lymphocytes with T-cells in immune responses. |
Bio-activity : | Determined by its ability to chemoattract human activated lymphocytes using a concentration of 10.0-100.0 ng/ml. |
Molecular Mass : | 7.8 kDa |
AA Sequence : | GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Ccl22 chemokine (C-C motif) ligand 22 [ Mus musculus (house mouse) ] |
Official Symbol | Ccl22 |
Synonyms | Ccl22; chemokine (C-C motif) ligand 22; MDC; DCBCK; ABCD-1; Scya22; C-C motif chemokine 22; CC chemokine ABCD-1; SMALL INDUCIBLE CYTOKINE A22 PRECURSOR (CC CHEMOKINE ABCD-1) (ACTIVATED B AND DENDRITIC CELL-DERIVED); activated B and dendritic cell-derived; dendritic cell and B cell derived chemokine; small inducible cytokine subfamily A, member 22; small inducible cytokine subfamily A22; small-inducible cytokine A22 |
Gene ID | 20299 |
mRNA Refseq | NM_009137 |
Protein Refseq | NP_033163 |
UniProt ID | O88430 |
◆ Recombinant Proteins | ||
Ccl22-703R | Recombinant Rat Ccl22 protein, His & GST-tagged | +Inquiry |
CCL22-18H | Active Recombinant Human CCL22, HIgG1 Fc-tagged | +Inquiry |
CCL22-3861M | Active Recombinant Mouse Chemokine (C-C motif) Ligand 22, MIgG2a Fc-tagged, mutant | +Inquiry |
CCL22-978M | Recombinant Mouse CCL22 protein, His-tagged | +Inquiry |
Ccl22-042C | Active Recombinant Mouse Ccl22 Protein (68 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL22-7728HCL | Recombinant Human CCL22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl22 Products
Required fields are marked with *
My Review for All Ccl22 Products
Required fields are marked with *
0
Inquiry Basket