Recombinant Mouse CCL8 Protein
Cat.No. : | CCL8-35M |
Product Overview : | Recombinant Mouse CCL8 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Monocyte chemotactic protein 2 (MCP-2), also known as CCL8, is a cytokine that is important during allergic and inflammatory responses. MCP-2 activates mast cells, eosinophils, and basophils through the G protein-coupled chemokine receptors CCR1, CCR2B, and CCR5. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 8.5 kDa (74 aa) |
AA Sequence : | GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Ccl8 chemokine (C-C motif) ligand 8 [ Mus musculus (house mouse) ] |
Official Symbol | CCL8 |
Synonyms | CCL8; chemokine (C-C motif) ligand 8; C-C motif chemokine 8; small inducible cytokine A8; small-inducible cytokine A8; monocyte chemotactic protein 2; monocyte chemoattractant protein 2; monocyte chemoattractant protein-2; HC14; Mcp2; MCP-2; Scya8; AB023418; 1810063B20Rik; |
Gene ID | 20307 |
mRNA Refseq | NM_021443 |
Protein Refseq | NP_067418 |
UniProt ID | Q9Z121 |
◆ Recombinant Proteins | ||
Ccl8-285M | Active Recombinant Mouse Chemokine (C-C Motif) Ligand 8 | +Inquiry |
CCL8-1266H | Recombinant Human CCL8 Protein (Gln24-Pro99), C-His tagged | +Inquiry |
CCL8-198H | Recombinant Human CCL8, SUMO tagged | +Inquiry |
CCL8-2656H | Recombinant Human CCL8 protein, GST-tagged | +Inquiry |
CCL8-303H | Active Recombinant Human Chemokine (C-C Motif) Ligand 8, MIgG2a Fc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL8 Products
Required fields are marked with *
My Review for All CCL8 Products
Required fields are marked with *