Recombinant Mouse Csf1 protein
Cat.No. : | Csf1-100M |
Product Overview : | Recombinant Mouse Csf1 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 230 |
Description : | Macrophage Colony Stimulating Factor (M-CSF), also named CSF-1, is a hematopoietic growth factor that is involved in the proliferation, differentiation, and survival of monocytes, macrophages, and bone marrow progenitor cells. It is produced by osteoblasts (as a result of endocrine stimulation by parathyroid hormone) exerts paracrine effects on osteoclasts and can interact with CSF1R. M-CSF is a four α-helical bundle cytokine and its active form is found extracellularly as a disulfide-linked homodimer. Four transcript variants encoding three different isoforms have been reported for M-CSF gene. Although forms may vary, all of them contain the N-terminal 150 a.a. portion that is necessary and sufficient for interaction with the receptor. The first 229 a.a. of mature mouse M-CSF shares 87 %, 83 %, 82 % and 81 % sequence identity with corresponding regions of rat, dog, cow and human M-CSF, respectively. Human M-CSF is active in the mouse, but mouse M-CSF is reported to be species-specific. |
Form : | Lyophilized from a 0.2μm filtered solution in 20 mM Tris, 500 mM NaCl, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine M-NFS-60 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 52.0 kDa, a disulfide-linked homodimer consisting of two 230 amino acid polypeptide chains. |
AA Sequence : | KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE |
Endotoxin : | Less than 1 EU/μg of rMuM-CSF as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Csf1 |
Official Symbol | Csf1 |
Synonyms | CSF1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; osteopetrosis; op; Csfm; MCSF; C87615; |
Gene ID | 12977 |
mRNA Refseq | NM_001113529 |
Protein Refseq | NP_001107001 |
UniProt ID | Q3U4F9 |
◆ Recombinant Proteins | ||
Csf1-1107M | Recombinant Mouse Csf1 Protein, His-tagged | +Inquiry |
CSF1-083C | Active Recombinant Human CSF1 Protein (1-149 aa) | +Inquiry |
Csf1-2161R | Recombinant Rat Csf1 Protein, His&GST-tagged | +Inquiry |
RFL21736HF | Recombinant Full Length Human Granulocyte-Macrophage Colony-Stimulating Factor(Csf2) Protein, His-Tagged | +Inquiry |
CSF1-339H | Recombinant Human Colony Stimulating Factor 1 (macrophage) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF1-001MCL | Recombinant Mouse CSF1 cell lysate | +Inquiry |
CSF1-1934HCL | Recombinant Human CSF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Csf1 Products
Required fields are marked with *
My Review for All Csf1 Products
Required fields are marked with *
0
Inquiry Basket