Recombinant Mouse Il17f Protein
Cat.No. : | Il17f-142M |
Product Overview : | Purified recombinant protein of Mouse interleukin 17F (Il17f) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Ligand for IL17RA and IL17RC. The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC. Involved in stimulating the production of other cytokines such as IL6, IL8 and CSF2, and in regulation of cartilage matrix turnover. Also involved in stimulating the proliferation of peripheral blood mononuclear cells and T-cells and in inhibition of angiogenesis. Plays a role in the induction of neutrophilia in the lungs and in the exacerbation of antigen-induced pulmonary allergic inflammation. |
Molecular Mass : | 30 kDa |
AA Sequence : | MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Il17f interleukin 17F [ Mus musculus (house mouse) ] |
Official Symbol | Il17f |
Synonyms | Il17f; interleukin 17F; C87042; IL-17F; interleukin-17F |
Gene ID | 257630 |
mRNA Refseq | NM_145856 |
Protein Refseq | NP_665855 |
UniProt ID | Q7TNI7 |
◆ Recombinant Proteins | ||
IL17F-114H | Active Recombinant Human Interleukin 17F | +Inquiry |
IL17F-434H | Active Recombinant Human IL17F protein | +Inquiry |
IL17F-3974H | Recombinant Human IL17F Protein (Arg31-Gln163), C-His tagged | +Inquiry |
IL17F-367H | Active Recombinant Human Interleukin 17F, HIgG1 Fc-tagged | +Inquiry |
Il17f-204R | Recombinant Rat Interleukin 17F | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17F-2045HCL | Recombinant Human IL17F cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il17f Products
Required fields are marked with *
My Review for All Il17f Products
Required fields are marked with *
0
Inquiry Basket