Recombinant Mouse Il33 Protein
Cat.No. : | Il33-157M |
Product Overview : | Purified recombinant protein of Mouse interleukin 33 (Il33), transcript variant 1 without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets. This form is rapidely lost upon angiogenic or proinflammatory activation. |
Molecular Mass : | 17.6 kDa |
AA Sequence : | MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI* |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | Il33 interleukin 33 [ Mus musculus (house mouse) ] |
Official Symbol | Il33 |
Synonyms | Il33; interleukin 33; Il-33; Il1f11; NF-HEV; 9230117N10Rik; interleukin-33; nuclear factor from high endothelial venules |
Gene ID | 77125 |
mRNA Refseq | NM_001164724 |
Protein Refseq | NP_001158196 |
UniProt ID | Q8BVZ5 |
◆ Recombinant Proteins | ||
IL33-0291C | Recombinant Cynomolgus IL33 protein, His-tagged | +Inquiry |
Il33-1679M | Recombinant Mouse Il33 Protein, His-tagged | +Inquiry |
Il33-286R | Recombinant Rat Interleukin 33 | +Inquiry |
Il33-50R | Recombinant Rat Il33 protein, His-tagged | +Inquiry |
Il33-157M | Recombinant Mouse Il33 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL33-5226HCL | Recombinant Human IL33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il33 Products
Required fields are marked with *
My Review for All Il33 Products
Required fields are marked with *
0
Inquiry Basket