Recombinant Human IL33 protein, GST-tagged

Cat.No. : IL33-301497H
Product Overview : Recombinant Human IL33 (109-266 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met109-Ile266
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name IL33 interleukin 33 [ Homo sapiens ]
Official Symbol IL33
Synonyms IL33; interleukin 33; C9orf26, chromosome 9 open reading frame 26 (NF HEV); interleukin-33; DKFZp586H0523; DVS27; DVS27 related protein; IL1F11; interleukin 1 family; member 11; NF HEV; nuclear factor for high endothelial venules; IL-33; IL-1F11; DVS27-related protein; interleukin-1 family member 11; nuclear factor from high endothelial venules; NF-HEV; NFEHEV; C9orf26; RP11-575C20.2;
Gene ID 90865
mRNA Refseq NM_001199640
Protein Refseq NP_001186569
MIM 608678
UniProt ID O95760

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL33 Products

Required fields are marked with *

My Review for All IL33 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon