Recombinant Human IL33 protein, GST-tagged
Cat.No. : | IL33-301497H |
Product Overview : | Recombinant Human IL33 (109-266 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met109-Ile266 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | IL33 interleukin 33 [ Homo sapiens ] |
Official Symbol | IL33 |
Synonyms | IL33; interleukin 33; C9orf26, chromosome 9 open reading frame 26 (NF HEV); interleukin-33; DKFZp586H0523; DVS27; DVS27 related protein; IL1F11; interleukin 1 family; member 11; NF HEV; nuclear factor for high endothelial venules; IL-33; IL-1F11; DVS27-related protein; interleukin-1 family member 11; nuclear factor from high endothelial venules; NF-HEV; NFEHEV; C9orf26; RP11-575C20.2; |
Gene ID | 90865 |
mRNA Refseq | NM_001199640 |
Protein Refseq | NP_001186569 |
MIM | 608678 |
UniProt ID | O95760 |
◆ Recombinant Proteins | ||
IL33-120M | Active Recombinant Mouse Interleukin 33, MIgG2a Fc-tagged, mutant | +Inquiry |
IL33-110H | Recombinant Human IL33 Protein | +Inquiry |
IL33-2218H | Active Recombinant Human IL33 protein, His-tagged | +Inquiry |
IL33-163M | Recombinant Mouse IL33 Protein | +Inquiry |
IL33-301497H | Recombinant Human IL33 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL33-5226HCL | Recombinant Human IL33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL33 Products
Required fields are marked with *
My Review for All IL33 Products
Required fields are marked with *