"Il4" Related Products

Recombinant Mouse Il4 Protein

Cat.No. : Il4-5181M
Product Overview : Mouse Il4 (P07750, 21 a.a. - 140 a.a.) partial recombinant protein expressed in Escherichia coli.
Description : The interleukin 4 (IL4, IL-4) is a cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. Upon activation by IL-4, Th2 cells subsequently produce additional IL-4 in a positive feedback loop. The cell that initially produces IL-4, thus inducing Th0 differentiation, has not been identified, but recent studies suggest that basophils may be the effector cell. It is closely related and has functions similar to Interleukin 13.
Source : E. coli
Species : Mouse
Form : Lyophilized
Bio-activity : The ED50 was determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 2 x 106 units/mg.
Molecular Mass : 14 kDa
AA Sequence : HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Endotoxin : Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 0.1 ng/μg (1EU/μg).
Purity : > 90% by SDS-PAGE and HPLC
Applications : Functional Study
SDS-PAGE
Storage : Store at -20 centigrade on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4 centigrade for 1 month or store at -20 centigrade for 6 months. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : Lyophilized from PBS, pH 7.0
Gene Name : Il4 interleukin 4 [ Mus musculus ]
Official Symbol : Il4
Synonyms : IL4; interleukin 4; interleukin-4; IGG1 induction factor; B-cell growth factor 1; B-cell stimulatory factor 1; lymphocyte stimulatory factor 1; B-cell IgG differentiation factor; Il-4; BSF-1;
Gene ID : 16189
mRNA Refseq : NM_021283
Protein Refseq : NP_067258

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.