Active Recombinant Mouse Il4 Protein
Cat.No. : | Il4-5181M |
Product Overview : | Mouse Il4 (P07750, 21 a.a. - 140 a.a.) partial recombinant protein expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 21-140 a.a. |
Description : | The interleukin 4 (IL4, IL-4) is a cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. Upon activation by IL-4, Th2 cells subsequently produce additional IL-4 in a positive feedback loop. The cell that initially produces IL-4, thus inducing Th0 differentiation, has not been identified, but recent studies suggest that basophils may be the effector cell. It is closely related and has functions similar to Interleukin 13. |
Form : | Lyophilized |
Bio-activity : | The ED50 was determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 2 x 106 units/mg. |
Molecular Mass : | 14 kDa |
AA Sequence : | HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS |
Endotoxin : | Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 0.1 ng/μg (1EU/μg). |
Purity : | > 90% by SDS-PAGE and HPLC |
Applications : | Functional Study SDS-PAGE |
Storage : | Store at -20 centigrade on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4 centigrade for 1 month or store at -20 centigrade for 6 months. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | Lyophilized from PBS, pH 7.0 |
Gene Name | Il4 interleukin 4 [ Mus musculus ] |
Official Symbol | Il4 |
Synonyms | IL4; interleukin 4; interleukin-4; IGG1 induction factor; B-cell growth factor 1; B-cell stimulatory factor 1; lymphocyte stimulatory factor 1; B-cell IgG differentiation factor; Il-4; BSF-1; |
Gene ID | 16189 |
mRNA Refseq | NM_021283 |
Protein Refseq | NP_067258 |
◆ Recombinant Proteins | ||
IL4-094I | Active Recombinant Human IL4 Protein (130 aa) | +Inquiry |
IL4-921C | Active Recombinant Canine IL4 Protein (His25-His132) | +Inquiry |
IL4-3104D | Recombinant Dog IL4 protein, His-tagged | +Inquiry |
IL4-5334H | Recombinant Human Interleukin 4, HQ-tagged | +Inquiry |
Il4-315M | Recombinant Mouse Il4, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL4-001MCL | Recombinant Mouse IL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il4 Products
Required fields are marked with *
My Review for All Il4 Products
Required fields are marked with *
0
Inquiry Basket