Active Recombinant Mouse Il9 Protein

• Cat.No.: Il9-119M
• Product Overview: Purified recombinant protein of Mouse interleukin 9 (Il9) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Supports IL-2 independent and IL-4 independent growth of helper T-cells.
• Bio-activity: The ED50 as determined by the dose-dependent proliferation of human MO7e cells is > 0.5 ng/ml, corresponding to a specific activity of > 2 x 10^6 units/mg.
• Molecular Mass: 14.3 kDa
• AA Sequence: MQRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTMSFLKSLLGTFQKTEMQRQKSRP
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Il9 interleukin 9 [ Mus musculus (house mouse) ]
• Official Symbol: Il9
• Synonyms: Il9; interleukin 9; P40; Il-9; interleukin-9; T-cell growth factor P40; cytokine P40
• Gene ID: 16198
• mRNA Refseq: NM_008373
• Protein Refseq: NP_032399
• UniProt ID: P15247