Active Recombinant Mouse Il9 Protein

Cat.No. : Il9-119M
Product Overview : Purified recombinant protein of Mouse interleukin 9 (Il9) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Supports IL-2 independent and IL-4 independent growth of helper T-cells.
Bio-activity : The ED50 as determined by the dose-dependent proliferation of human MO7e cells is > 0.5 ng/ml, corresponding to a specific activity of > 2 x 10^6 units/mg.
Molecular Mass : 14.3 kDa
AA Sequence : MQRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTMSFLKSLLGTFQKTEMQRQKSRP
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Il9 interleukin 9 [ Mus musculus (house mouse) ]
Official Symbol Il9
Synonyms Il9; interleukin 9; P40; Il-9; interleukin-9; T-cell growth factor P40; cytokine P40
Gene ID 16198
mRNA Refseq NM_008373
Protein Refseq NP_032399
UniProt ID P15247

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il9 Products

Required fields are marked with *

My Review for All Il9 Products

Required fields are marked with *

0
cart-icon