Recombinant Rat CCL3 Protein
Cat.No. : | CCL3-24R |
Product Overview : | Recombinant Rat CCL3 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Description : | Macrophage inflammatory protein-1 alpha (MIP-1 α), also known as CCL3, is a cytokine produced by macrophages. MIP-1 α binds the chemokine receptors CCR1, CCR4 and CCR5 to induce inflammatory responses, including the recruitment of granulocytes and neutrophil superoxide production. The MIP-1 α and MIP-1 β heterodimer exhibits antiviral activity against the human immunodeficiency virus 1 (HIV-1). |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Noncovalently-linked dimers, 7.9 kDa (69 aa) |
AA Sequence : | APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Ccl3 chemokine (C-C motif) ligand 3 [ Rattus norvegicus (Norway rat) ] |
Official Symbol | CCL3 |
Synonyms | CCL3; chemokine (C-C motif) ligand 3; C-C motif chemokine 3; MIP-1-alpha; small inducible cytokine A3; small-inducible cytokine A3; macrophage inflammatory protein 1-alpha; Macrophage inflammatory protein 1 alpha (Small inducible cytokine A3); Scya3; MIP-1a; |
Gene ID | 25542 |
mRNA Refseq | NM_013025 |
Protein Refseq | NP_037157 |
UniProt ID | P50229 |
◆ Recombinant Proteins | ||
CCL3-330C | Active Recombinant Human CCL3 Protein (70 aa) | +Inquiry |
Ccl3-23M | Active Recombinant Mouse CCL3 Protein | +Inquiry |
CCL3-276H | Recombinant Human CCL3, StrepII-tagged | +Inquiry |
CCL3-151H | Recombinant Human CCL3 Protein, His-tagged | +Inquiry |
CCL3-243H | Recombinant Human C motif chemokine ligand 3 Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL3-7723HCL | Recombinant Human CCL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL3 Products
Required fields are marked with *
My Review for All CCL3 Products
Required fields are marked with *
0
Inquiry Basket