Recombinant Human CCL3 Protein, GST-Tagged
Cat.No. : | CCL3-0637H |
Product Overview : | Human CCL3 full-length ORF (NP_002974.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.[provided by RefSeq, Sep 2010] |
Molecular Mass : | 36.5 kDa |
AA Sequence : | MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCL3 chemokine (C-C motif) ligand 3 [ Homo sapiens ] |
Official Symbol | CCL3 |
Synonyms | CCL3; chemokine (C-C motif) ligand 3; SCYA3, small inducible cytokine A3 (homologous to mouse Mip 1a); C-C motif chemokine 3; G0S19 1; LD78ALPHA; MIP 1 alpha; SIS-beta; PAT 464.1; G0/G1 switch regulatory protein 19-1; macrophage inflammatory protein 1-alpha; tonsillar lymphocyte LD78 alpha protein; small inducible cytokine A3 (homologous to mouse Mip-1a); MIP1A; SCYA3; G0S19-1; MIP-1-alpha; |
Gene ID | 6348 |
mRNA Refseq | NM_002983 |
Protein Refseq | NP_002974 |
MIM | 182283 |
UniProt ID | P10147 |
◆ Recombinant Proteins | ||
CCL3-29859TH | Recombinant Human CCL3, His-tagged | +Inquiry |
CCL3-519R | Recombinant Rhesus Macaque CCL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL3-021H | Recombinant Human CCL3 Protein, Biotinylated | +Inquiry |
CCL3-705H | Recombinant Human CCL3 protein, His & GST-tagged | +Inquiry |
CCL3-15H | Active Recombinant Human CCL3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL3-7723HCL | Recombinant Human CCL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL3 Products
Required fields are marked with *
My Review for All CCL3 Products
Required fields are marked with *
0
Inquiry Basket