Active Recombinant Rat Cxcl10 Protein (77 aa)
Cat.No. : | Cxcl10-175C |
Product Overview : | Recombinant rat IP-10/CRG-2/CXCL10 produced in HEK 293 cells is a polypeptide chain containing 77 amino acids. A fully biologically active molecule, rr IP-10/CRG-2/CXCL10 has a molecular mass of 8.7 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | HEK293 |
Protein Length : | 77 |
Description : | C-X-C motif chemokine 10 (CXCL10) also known as interferon gamma-induced protein 10 (IP-10) or small-inducible cytokine B10, is originally identified as an IFN-γ-inducible gene in monocytes, fibroblasts and endothelial cells. It has since been shown that IP-10 mRNA is also induced by LPS, IL-1β, TNF-α, IL-12 and viruses. Additional cell types that have been shown to express IP-10 include activated T-lymphocytes, splenocytes, keratinocytes, osteoblasts, astrocytes, and smooth muscle cells. IP-10 is also expressed in psoriatic and lepromatous lesions of the skin. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The EC50 value of rat IP-10/CRG-2/CXCL10 on Ca^2+ mobilization assay in CHO-K1/Gα15/rCXCR3 cells (human Gα15 and rat CXCR3 stably expressed in CHO-K1 cells) is less than 300 ng/mL. |
Molecular Mass : | 8.7 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | IPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHVEIIATMKKNNEKRCLNPESEAIKSLLKAVSQRRSKRAP |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 98% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Rat IP-10/CRG-2/CXCL10 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat IP-10/CRG-2/CXCL10 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Cxcl10 chemokine (C-X-C motif) ligand 10 [ Rattus norvegicus ] |
Official Symbol | Cxcl10 |
Synonyms | CXCL10; chemokine (C-X-C motif) ligand 10; C-X-C motif chemokine 10; gamma-IP10; protein Mob-1; small-inducible cytokine B10; interferon-inducible protein 10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; small inducible cytokine B subfamily (Cys-X-Cys) member 10; small inducible cytokine B subfamily (Cys-X-Cys), member 10; IP-10; Scyb10; |
Gene ID | 245920 |
mRNA Refseq | NM_139089 |
Protein Refseq | NP_620789 |
UniProt ID | Q6GTC7 |
◆ Recombinant Proteins | ||
Cxcl10-2774H | Recombinant Hamster Cxcl10 Protein, His-tagged | +Inquiry |
CXCL10-5006H | Recombinant Human CXCL10 protein, His-tagged | +Inquiry |
CXCL10-71M | Recombinant Mouse CXCL10 (IP-10) | +Inquiry |
CXCL10-4648R | Recombinant Rhesus macaque CXCL10 protein, His-tagged | +Inquiry |
Cxcl10-190M | Recombinant Mouse X-C motif chemokine ligand 10 Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL10-7172HCL | Recombinant Human CXCL10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cxcl10 Products
Required fields are marked with *
My Review for All Cxcl10 Products
Required fields are marked with *
0
Inquiry Basket