Recombinant Human CXCL10 Protein, Myc-His-tagged

Cat.No. : CXCL10-5006H
Product Overview : Recombinant Human CXCL10 Protein(P02778)(22-98 aa), fused with N-terminal Myc tag and His tag, was expressed in Mammalian Cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : His&Myc
Protein Length : 22-98 aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Molecular Mass : 12.6kDa
AASequence : VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name CXCL10 chemokine (C-X-C motif) ligand 10 [ Homo sapiens ]
Official Symbol CXCL10
Synonyms CXCL10; chemokine (C-X-C motif) ligand 10; INP10, SCYB10, small inducible cytokine subfamily B (Cys X Cys), member 10; C-X-C motif chemokine 10; C7; crg 2; gIP 10; IFI10; IP 10; mob 1; gamma IP10; gamma-IP10; small-inducible cytokine B10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10;
Gene ID 3627
mRNA Refseq NM_001565
Protein Refseq NP_001556
MIM 147310
UniProt ID P02778

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL10 Products

Required fields are marked with *

My Review for All CXCL10 Products

Required fields are marked with *

0
cart-icon
0
compare icon