Recombinant Human CXCL10 Protein, Myc-His-tagged
| Cat.No. : | CXCL10-5006H |
| Product Overview : | Recombinant Human CXCL10 Protein(P02778)(22-98 aa), fused with N-terminal Myc tag and His tag, was expressed in Mammalian Cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | His&Myc |
| Protein Length : | 22-98 aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
| Molecular Mass : | 12.6kDa |
| AASequence : | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | CXCL10 chemokine (C-X-C motif) ligand 10 [ Homo sapiens ] |
| Official Symbol | CXCL10 |
| Synonyms | CXCL10; chemokine (C-X-C motif) ligand 10; INP10, SCYB10, small inducible cytokine subfamily B (Cys X Cys), member 10; C-X-C motif chemokine 10; C7; crg 2; gIP 10; IFI10; IP 10; mob 1; gamma IP10; gamma-IP10; small-inducible cytokine B10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10; |
| Gene ID | 3627 |
| mRNA Refseq | NM_001565 |
| Protein Refseq | NP_001556 |
| MIM | 147310 |
| UniProt ID | P02778 |
| ◆ Recombinant Proteins | ||
| CXCL10-938R | Recombinant Rat CXCL10 Protein (Ile22-Pro98), His-tagged | +Inquiry |
| CXCL10-08H | Recombinant Human CXCL10 protein | +Inquiry |
| CXCL10-101H | Recombinant Human CXCL10 Protein, DYKDDDDK-tagged | +Inquiry |
| CXCL10-86R | Recombinant Rat CXCL10 | +Inquiry |
| CXCL10-522C | Recombinant Cattle CXCL10 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL10-7172HCL | Recombinant Human CXCL10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL10 Products
Required fields are marked with *
My Review for All CXCL10 Products
Required fields are marked with *
