Recombinant Human CXCL10 Protein, Myc-His-tagged

• Cat.No.: CXCL10-5006H
• Product Overview: Recombinant Human CXCL10 Protein(P02778)(22-98 aa), fused with N-terminal Myc tag and His tag, was expressed in Mammalian Cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: His&Myc
• Protein Length: 22-98 aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Molecular Mass: 12.6kDa
• AASequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: CXCL10 chemokine (C-X-C motif) ligand 10 [ Homo sapiens ]
• Official Symbol: CXCL10
• Synonyms: CXCL10; chemokine (C-X-C motif) ligand 10; INP10, SCYB10, small inducible cytokine subfamily B (Cys X Cys), member 10; C-X-C motif chemokine 10; C7; crg 2; gIP 10; IFI10; IP 10; mob 1; gamma IP10; gamma-IP10; small-inducible cytokine B10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10
• Gene ID: 3627
• mRNA Refseq: NM_001565
• Protein Refseq: NP_001556
• MIM: 147310
• UniProt ID: P02778