Active Recombinant Human CCL1 Protein (73 aa)
| Cat.No. : | CCL1-266C |
| Product Overview : | Recombinant Human I-309/CCL1 produced in CHO cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rhI-309/CCL1 has a molecular mass of 15kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | CHO |
| Protein Length : | 73 |
| Description : | Chemokine (C-C motif) ligand 1 (CCL1), also known as I-309, is a small glycoprotein secreted by activated T cells that belongs to the family of chemokines. Human CCL1 has been assumed to be a homologue of mouse TCA3. While the two proteins share only approximately 42% amino acid sequence identity, both chemokines contain an extra pair of cysteine residues not found in most other chemokines. CCL1 attracts monocytes, NK cells, immature B cells and dendritic cells by interacting with the cell surface chemokine receptor CCR8. This chemokine resides in a large cluster of CC chemokines on human chromosome 17. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | The EC50 value of human I-309/CCL1 on Ca^2+ mobilization assay in CHO-K1/Gα15/hCCR8 cells (human Gα15 and human CCR8 stably expressed in CHO-K1 cells) is less than 1 μg/mL. |
| Molecular Mass : | 15 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : | KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 98% as analyzed by SDS-PAGE. |
| Storage : | Lyophilized recombinant Human I-309/CCL1 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant human I-309/CCL1 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
| Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
| Gene Name | CCL1 chemokine (C-C motif) ligand 1 [ Homo sapiens ] |
| Official Symbol | CCL1 |
| Synonyms | CCL1; chemokine (C-C motif) ligand 1; SCYA1, small inducible cytokine A1 (I 309, homologous to mouse Tca 3); C-C motif chemokine 1; I 309; inflammatory cytokine I 309; P500; SISe; T lymphocyte secreted protein I 309; TCA3; inflammatory cytokine I-309; small-inducible cytokine A1; T lymphocyte-secreted protein I-309; small inducible cytokine A1 (I-309, homologous to mouse Tca-3); I-309; SCYA1; |
| Gene ID | 6346 |
| mRNA Refseq | NM_002981 |
| Protein Refseq | NP_002972 |
| MIM | 182281 |
| UniProt ID | P22362 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL1 Products
Required fields are marked with *
My Review for All CCL1 Products
Required fields are marked with *



