Active Recombinant Human CCL21 Protein (111 aa)
Cat.No. : | CCL21-122C |
Product Overview : | Recombinant Human CCL21 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 111 |
Description : | Exodus-2/CCL21 is a novel CC chemokine discovered independently by three groups from the EST database, and shows 21-33% identity to other CC chemokines. Exodus-2 contains the four conserved cysteines characteristic of β chemokines plus two additional cysteines in its unusually long carboxylterminal domain. It is expressed in lymph nodes of certain endothelial cells, and in the spleen and appendix. Exodus-2 chemoattracts T and B lymphocytes and inhibits hematopoiesis. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. Determined by its ability to chemoattract human total lymphocyte population using a concentration range of 10.0-100.0 ng/mL, corresponding to a Specific Activity of >1 × 10^4 IU/mg. |
Molecular Mass : | 12.2 kDa, a single, non-glycosylated polypeptide chain containing 111 amino acids. |
AA Sequence : | SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCRKTERSQTPKGP |
Endotoxin : | Less than 1 EU/mg of rHuExodus/CCL21 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CCL21 chemokine (C-C motif) ligand 21 [ Homo sapiens ] |
Official Symbol | CCL21 |
Synonyms | CCL21; chemokine (C-C motif) ligand 21; SCYA21, small inducible cytokine subfamily A (Cys Cys), member 21; C-C motif chemokine 21; 6Ckine; beta chemokine exodus 2; CKb9; ECL; Efficient Chemoattractant for Lymphocytes; exodus 2; secondary lymphoid tissue chemokine; SLC; TCA4; exodus-2; beta chemokine exodus-2; beta-chemokine exodus-2; small-inducible cytokine A21; secondary lymphoid-tissue chemokine; small inducible cytokine subfamily A (Cys-Cys), member 21; SCYA21; MGC34555; |
Gene ID | 6366 |
mRNA Refseq | NM_002989 |
Protein Refseq | NP_002980 |
MIM | 602737 |
UniProt ID | O00585 |
◆ Recombinant Proteins | ||
CCL21-2653H | Recombinant Human CCL21 protein, GST-tagged | +Inquiry |
CCL21-341H | Recombinant Human Chemokine (C-C motif) Ligand 21 | +Inquiry |
CCL21-522H | Active Recombinant Human CCL21 | +Inquiry |
CCL21-151H | Recombinant Human CCL21 Protein, DYKDDDDK-tagged | +Inquiry |
CCL21-4372H | Recombinant Human CCL21 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL21-552HCL | Recombinant Human CCL21 cell lysate | +Inquiry |
CCL21-424CCL | Recombinant Cynomolgus CCL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL21 Products
Required fields are marked with *
My Review for All CCL21 Products
Required fields are marked with *
0
Inquiry Basket