Recombinant Full Length Human CCL21 Protein, GST-tagged
Cat.No. : | CCL21-2963HF |
Product Overview : | Human CCL21 full-length ORF (NP_002980.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 134 amino acids |
Description : | This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis. This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils. The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs. It is a high affinity functional ligand for chemokine receptor 7 that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19). [provided by RefSeq, Sep 2014] |
Molecular Mass : | 41 kDa |
AA Sequence : | MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCL21 chemokine (C-C motif) ligand 21 [ Homo sapiens ] |
Official Symbol | CCL21 |
Synonyms | CCL21; chemokine (C-C motif) ligand 21; SCYA21, small inducible cytokine subfamily A (Cys Cys), member 21; C-C motif chemokine 21; 6Ckine; beta chemokine exodus 2; CKb9; ECL; Efficient Chemoattractant for Lymphocytes; exodus 2; secondary lymphoid tissue chemokine; SLC; TCA4; exodus-2; beta chemokine exodus-2; beta-chemokine exodus-2; small-inducible cytokine A21; secondary lymphoid-tissue chemokine; small inducible cytokine subfamily A (Cys-Cys), member 21; SCYA21; MGC34555; |
Gene ID | 6366 |
mRNA Refseq | NM_002989 |
Protein Refseq | NP_002980 |
MIM | 602737 |
UniProt ID | O00585 |
◆ Recombinant Proteins | ||
CCL-329H | Recombinant Human Chemokine (C-C Motif) Ligand 21, His-tagged | +Inquiry |
CCL21-341H | Recombinant Human Chemokine (C-C motif) Ligand 21 | +Inquiry |
CCL21-626H | Active Recombinant Human CCL21 protein(Met1-Pro134) | +Inquiry |
CCL21-373C | Recombinant Cynomolgus CCL21 Protein, His-tagged | +Inquiry |
CCL-328M | Active Recombinant Mouse Chemokine (C-C Motif) Ligand 21A (Serine) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL21-552HCL | Recombinant Human CCL21 cell lysate | +Inquiry |
CCL21-424CCL | Recombinant Cynomolgus CCL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL21 Products
Required fields are marked with *
My Review for All CCL21 Products
Required fields are marked with *