Active Recombinant Human CD40 protein, hFc-tagged
Cat.No. : | CD40-837H |
Product Overview : | Recombinant Human CD40 protein(P25942)(21-193aa), fused to C-terminal hFc tag, was expressed in Mammalian cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Fc |
Protein Length : | 21-193aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Bio-activity : | 1. Measured by its binding ability in a functional ELISA. Immobilized CD40 at 2 μg/ml can bind CD40L, the EC50 is 3.112-3.858 ng/ml. 2. Human CD40 protein hFc tag captured on COOH chip can bind Human CD40L protein hFc and Flag tag with an affinity constant of 2.06 nM as detected by LSPR Assay. |
Molecular Mass : | 48 kDa |
AA Sequence : | EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR |
Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
Purity : | Greater than 92% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | CD40 CD40 molecule, TNF receptor superfamily member 5 [ Homo sapiens ] |
Official Symbol | CD40 |
Synonyms | CD40; CD40 molecule, TNF receptor superfamily member 5; TNFRSF5, tumor necrosis factor receptor superfamily, member 5; tumor necrosis factor receptor superfamily member 5; Bp50; p50; CD40L receptor; CD40 type II isoform; B cell-associated molecule; B cell surface antigen CD40; B-cell surface antigen CD40; CD40 antigen (TNF receptor superfamily member 5); tumor necrosis factor receptor superfamily, member 5; nerve growth factor receptor-related B-lymphocyte activation molecule; CDW40; TNFRSF5; MGC9013; |
Gene ID | 958 |
mRNA Refseq | NM_001250 |
Protein Refseq | NP_001241 |
MIM | 109535 |
UniProt ID | P25942 |
◆ Recombinant Proteins | ||
CD40-107H | Active Recombinant Human CD40 Protein, His-tagged | +Inquiry |
CD40-2221HAF647 | Recombinant Human CD40 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
CD40-3827H | Active Recombinant Human CD40 Protein, hFc-tagged, Site-specific Alexa Fluor 647-Labeled | +Inquiry |
CD40-153CAF555 | Recombinant Canine CD40 Protein, LEVLFQ-tagged, Alexa Fluor 555 conjugated | +Inquiry |
Cd40-6892MAF555 | Recombinant Mouse Cd40 Protein, Fc/His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD40-1262RCL | Recombinant Rat CD40 cell lysate | +Inquiry |
CD40-2617HCL | Recombinant Human CD40 cell lysate | +Inquiry |
CD40-1254CCL | Recombinant Cynomolgus CD40 cell lysate | +Inquiry |
CD40-1831MCL | Recombinant Mouse CD40 cell lysate | +Inquiry |
CD40-001CCL | Recombinant Canine CD40 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD40 Products
Required fields are marked with *
My Review for All CD40 Products
Required fields are marked with *
0
Inquiry Basket