Species : |
Human |
Source : |
E.coli |
Description : |
Ciliary neurotrophic factor (CNTF) is a neurotrophic factor that promotes the survival of neuronal cell populations, neurite outgrowth, and neurotransmitter synthesis. CNTF also plays an important protective role during nervous system injury. |
Bio-activity : |
TF-1 cell proliferation, ≤325 ng/mL |
Molecular Mass : |
Monomer, 22.9 kDa (200 aa) |
AA Sequence : |
MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM |
Endotoxin : |
≤1 EUs/μg, Kinetic LAL |
Purity : |
≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : |
12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : |
Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : |
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : |
Sterile water at 0.1 mg/mL |
Shipping : |
Room temperature |
Instructions : |
Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. If a precipitate is observed, centrifuge the solution thoroughly and use only the soluble fraction (removing it from the precipitate). A 10% overfill has been added to compensate for any loss of protein in the precipitate. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |