Recombinant Human CNTF protein, His-tagged
Cat.No. : | CNTF-2711H |
Product Overview : | Recombinant Human CNTF protein(P26441)(4-196aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 4-196aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.1 kDa |
AA Sequence : | TEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIAN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CNTF ciliary neurotrophic factor [ Homo sapiens ] |
Official Symbol | CNTF |
Synonyms | CNTF; ciliary neurotrophic factor; HCNTF; |
Gene ID | 1270 |
mRNA Refseq | NM_000614 |
Protein Refseq | NP_000605 |
MIM | 118945 |
UniProt ID | P26441 |
◆ Recombinant Proteins | ||
CNTF-1966HF | Recombinant Full Length Human CNTF Protein, GST-tagged | +Inquiry |
CNTF-2711H | Recombinant Human CNTF protein, His-tagged | +Inquiry |
CNTF-1606H | Recombinant Human CNTF Protein, GST-tagged | +Inquiry |
Cntf-296R | Recombinant Rat Ciliary Neurotrophic Factor | +Inquiry |
CNTF-2013H | Recombinant Human CNTF Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CNTF-26839TH | Native Human CNTF | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNTF-376HCL | Recombinant Human CNTF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNTF Products
Required fields are marked with *
My Review for All CNTF Products
Required fields are marked with *