Active Recombinant Human CSF1 Protein (159 aa)

Cat.No. : CSF1-335C
Product Overview : Recombinant human Macrophage Colony-Stimulating Factor 1 (rhM-CSF) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 159 amino acids each. A fully biologically active molecule, rhM-CSF has a molecular mass of 28 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary refolding and chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 159
Description : Macrophage Colony-Stimulating Factor 1 (M-CSF), involved especially in monocytopoiesis, is a hematopoietic growth factor. In mammals, it exits three isoforms, which invariably share an N-terminal 32-aa signal peptide, a 149-residue growth factor domain, a 21-residue transmembrane region and a 37-aa cytoplasmictail. The biological activity of human M-CSF is maintained within the 149-aa growth factor domain, and it is only active in the disulfide-linked dimeric form, which is bonded at Cys63.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 of 1 - 3 ng/mL, measured by cell proliferation assay of M-NFS-60, corresponding to a specific activity of 3.3 5-1 × 10^6 units/mg.
Molecular Mass : 28 kDa, observed by non-reducing SDS-PAGE.
AA Sequence : MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS
Endotoxin : < 1 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by non-reducing SDS-PAGE.
Storage : Lyophilized recombinant human Macrophage Colony-Stimulating Factor 1 (rhM-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhM-CSF should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against 50 mM Tris-HCl, pH 8.0.
Reconstitution : Reconstituted in ddH2O or PBS or Tris-HCl, pH 8.0 at 100 μg/mL.
Gene Name CSF1 colony stimulating factor 1 (macrophage) [ Homo sapiens ]
Official Symbol CSF1
Synonyms CSF1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; M CSF; MCSF; MGC31930; lanimostim; CSF-1;
Gene ID 1435
mRNA Refseq NM_000757
Protein Refseq NP_000748
MIM 120420
UniProt ID P09603

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSF1 Products

Required fields are marked with *

My Review for All CSF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon