Active Recombinant Human CSF1 Protein (159 aa)
Cat.No. : | CSF1-335C |
Product Overview : | Recombinant human Macrophage Colony-Stimulating Factor 1 (rhM-CSF) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 159 amino acids each. A fully biologically active molecule, rhM-CSF has a molecular mass of 28 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary refolding and chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 159 |
Description : | Macrophage Colony-Stimulating Factor 1 (M-CSF), involved especially in monocytopoiesis, is a hematopoietic growth factor. In mammals, it exits three isoforms, which invariably share an N-terminal 32-aa signal peptide, a 149-residue growth factor domain, a 21-residue transmembrane region and a 37-aa cytoplasmictail. The biological activity of human M-CSF is maintained within the 149-aa growth factor domain, and it is only active in the disulfide-linked dimeric form, which is bonded at Cys63. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 of 1 - 3 ng/mL, measured by cell proliferation assay of M-NFS-60, corresponding to a specific activity of 3.3 5-1 × 10^6 units/mg. |
Molecular Mass : | 28 kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : | MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS |
Endotoxin : | < 1 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by non-reducing SDS-PAGE. |
Storage : | Lyophilized recombinant human Macrophage Colony-Stimulating Factor 1 (rhM-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhM-CSF should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against 50 mM Tris-HCl, pH 8.0. |
Reconstitution : | Reconstituted in ddH2O or PBS or Tris-HCl, pH 8.0 at 100 μg/mL. |
Gene Name | CSF1 colony stimulating factor 1 (macrophage) [ Homo sapiens ] |
Official Symbol | CSF1 |
Synonyms | CSF1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; M CSF; MCSF; MGC31930; lanimostim; CSF-1; |
Gene ID | 1435 |
mRNA Refseq | NM_000757 |
Protein Refseq | NP_000748 |
MIM | 120420 |
UniProt ID | P09603 |
◆ Recombinant Proteins | ||
Csf1-222C | Active Recombinant Mouse Csf1 Protein | +Inquiry |
CSF1-425H | Recombinant Human CSF1 protein, His-tagged | +Inquiry |
CSF1-4028H | Recombinant Human CSF1 Protein (Glu33-Arg255), N-His tagged | +Inquiry |
Csf1-042M | Active Recombinant Mouse Csf1 Protein | +Inquiry |
CSF1-083C | Active Recombinant Human CSF1 Protein (1-149 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF1-1934HCL | Recombinant Human CSF1 cell lysate | +Inquiry |
CSF1-001MCL | Recombinant Mouse CSF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSF1 Products
Required fields are marked with *
My Review for All CSF1 Products
Required fields are marked with *