Active Recombinant Mouse Csf1 Protein

Cat.No. : Csf1-042M
Product Overview : Purified recombinant protein of Mouse colony stimulating factor 1 (macrophage) (Csf1), transcript variant 2 without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.
Bio-activity : The ED50 as determined by the dose-dependent stimulation of the proliferation of M-NFS-60 cells is > 1.0 ng/ml, corresponding to a specific activity of > 1 x 10^6 units/mg.
Molecular Mass : 36.4 kDa
AA Sequence : MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Csf1 colony stimulating factor 1 (macrophage) [ Mus musculus (house mouse) ]
Official Symbol Csf1
Synonyms Csf1; colony stimulating factor 1 (macrophage); op; Csfm; MCSF; C87615; macrophage colony-stimulating factor 1; osteopetrosis; EC 2.7.10.1
Gene ID 12977
mRNA Refseq NM_001113529
Protein Refseq NP_031804
UniProt ID P07141

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Csf1 Products

Required fields are marked with *

My Review for All Csf1 Products

Required fields are marked with *

0
cart-icon