Active Recombinant Human FGF19 Protein (195 aa)
Cat.No. : | FGF19-121F |
Product Overview : | Recombinant Human FGF19 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 195 |
Description : | Fibroblast growth factor 19 (FGF19) belongs to the large FGF family which has at least 23 members. All FGF family members are heparin binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. FGFs are expressed during embryonic development and in restricted adult tissues. Four distinct but related classes of FGF receptors, FGF R1, 2, 3, and 4, exist. Unlike most FGFs which bind to and activate more than one FGF receptor, FGF19 is a specific ligand for FGF R4. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent stimulation of the proliferation of balb/c 3T3 cells is 100-150 ng/mL, corresponding to a Specific Activity of >6.7× 10^3 IU/mg. |
Molecular Mass : | Approximately 21.8 kDa, a single non-glycosylated polypeptide chain containing 195 amino acids. |
AA Sequence : | MRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK |
Endotoxin : | Less than 1 EU/mg of rHuFGF-19 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | FGF19 fibroblast growth factor 19 [ Homo sapiens ] |
Official Symbol | FGF19 |
Synonyms | FGF19; fibroblast growth factor 19; FGF-19; |
Gene ID | 9965 |
mRNA Refseq | NM_005117 |
Protein Refseq | NP_005108 |
MIM | 603891 |
UniProt ID | O95750 |
◆ Recombinant Proteins | ||
FGF19-3332H | Recombinant Human FGF19 Protein (Gly4-Lys216), His tagged | +Inquiry |
FGF19-48H | Recombinant Human FGF19 Protein, His-tagged | +Inquiry |
Fgf19-1815R | Recombinant Rat Fgf19 protein, His-tagged | +Inquiry |
FGF19-238H | Recombinant Human FGF19 protein | +Inquiry |
FGF19-121F | Active Recombinant Human FGF19 Protein (195 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF19-6244HCL | Recombinant Human FGF19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF19 Products
Required fields are marked with *
My Review for All FGF19 Products
Required fields are marked with *
0
Inquiry Basket