Active Recombinant Human IL1A Protein
Cat.No. : | IL1A-148H |
Product Overview : | Recombinant Human IL1A Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Interleukin 1 alpha (IL-1α) is expressed by epithelial cells, activated macrophages, neutrophils, and endothelial cells to regulate immune responses. IL-1α signals through the IL-1 receptor, type 1 (IL-1R1) to activate the myeloid differentiation primary response 88 (MYD88) signaling pathway, which contains the cytoplasmic Toll/IL-1 receptor (TIR) domain adapter. IL-1α and the independently regulated IL-1β protein have overlapping proinflammatory activities to induce adhesion molecule expression on epithelial cells, control fever induction, initiate rheumatoid arthritis, and promote septic shock. |
Bio-activity : | D10S cell proliferation, ≤50 pg/mL; ≥2.0 x 10^7 units/mg |
Molecular Mass : | Monomer, 18 kDa (159 aa) |
AA Sequence : | SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | IL1A interleukin 1, alpha [ Homo sapiens (human) ] |
Official Symbol | IL1A |
Synonyms | IL1A; interleukin 1, alpha; IL1; interleukin-1 alpha; hematopoietin 1; IL 1A; IL1 ALPHA; IL1F1; preinterleukin 1 alpha; pro interleukin 1 alpha; IL-1 alpha; hematopoietin-1; pro-interleukin-1-alpha; IL-1A; IL1-ALPHA; |
Gene ID | 3552 |
mRNA Refseq | NM_000575 |
Protein Refseq | NP_000566 |
MIM | 147760 |
UniProt ID | P01583 |
◆ Recombinant Proteins | ||
IL1A-2464H | Recombinant Human IL1A Protein (Ser113-Ala271), C-His tagged | +Inquiry |
IL1A-631R | Recombinant Rabbit IL1A protein, His-tagged | +Inquiry |
IL1A-620D | Recombinant Dog IL1A protein, His-tagged | +Inquiry |
IL1A-2238R | Recombinant Rhesus monkey IL1A Protein, His-tagged | +Inquiry |
Il1a-099M | Active Recombinant Mouse Il1a Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1A-2911HCL | Recombinant Human IL1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1A Products
Required fields are marked with *
My Review for All IL1A Products
Required fields are marked with *
0
Inquiry Basket