| Species : |
Human |
| Source : |
E.coli |
| Protein Length : |
147 |
| Description : |
Interleukin-22(IL-22) belongs to a group of cytokines called the IL-10 family or IL-10 superfamily (including IL-19, IL-20, IL-24, and IL-26) which are a class of potent mediators of cellular inflammatory responses. It shares use of IL-10R2 in cell signaling with other members of this family, such as IL-10, IL-26, IL-28A/B and IL-29. IL-22 is produced by activated DC and T cells and initiates innate immune responses against bacterial pathogens in epithelial cells such as those in the lung and gut. IL-22 along with IL-17 is produced by splenic LTi-like cells and Th17 cells and likely plays a role in the coordinated response of both adaptive and innate immune systems.IL-22 signals through a receptor system consisting of IL-10R-ß/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
Measured by its ability to induce IL-10 secretion in COLO 205 (human colon carcinoma cells). The ED50 for this effect is less than 1 ng/mL. |
| Molecular Mass : |
16.9 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : |
MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
| Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
| Purity : |
> 98% as analyzed by SDS-PAGE. |
| Storage : |
Lyophilized recombinant human Interleukin-22 (IL-22) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human Interleukin-22 (IL-22) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
| Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
| Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |
