Active Recombinant Human IL22 Protein (147 aa)

Cat.No. : IL22-360I
Product Overview : Recombinant human Interleukin-22 (IL-22) produced in E. coli is a single non-glycosylated polypeptide chain containing 147 amino acids. A fully biologically active molecule, rhIL-22 has a molecular mass of 16.9 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 147
Description : Interleukin-22(IL-22) belongs to a group of cytokines called the IL-10 family or IL-10 superfamily (including IL-19, IL-20, IL-24, and IL-26) which are a class of potent mediators of cellular inflammatory responses. It shares use of IL-10R2 in cell signaling with other members of this family, such as IL-10, IL-26, IL-28A/B and IL-29. IL-22 is produced by activated DC and T cells and initiates innate immune responses against bacterial pathogens in epithelial cells such as those in the lung and gut. IL-22 along with IL-17 is produced by splenic LTi-like cells and Th17 cells and likely plays a role in the coordinated response of both adaptive and innate immune systems.IL-22 signals through a receptor system consisting of IL-10R-ß/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Measured by its ability to induce IL-10 secretion in COLO 205 (human colon carcinoma cells). The ED50 for this effect is less than 1 ng/mL.
Molecular Mass : 16.9 kDa, observed by reducing SDS-PAGE.
AA Sequence : MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 98% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant human Interleukin-22 (IL-22) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human Interleukin-22 (IL-22) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name IL22 interleukin 22 [ Homo sapiens ]
Official Symbol IL22
Synonyms IL22; interleukin 22; interleukin-22; IL 10 related T cell derived inducible factor; IL 21; IL 22; IL D110; IL TIF; ILTIF; MGC79382; MGC79384; TIFa; TIFIL 23; zcyto18; cytokine Zcyto18; IL-10-related T-cell-derived inducible factor; IL-10-related T-cell-derived-inducible factor; IL-21; IL-22; IL-TIF; IL-D110; TIFIL-23;
Gene ID 50616
mRNA Refseq NM_020525
Protein Refseq NP_065386
MIM 605330
UniProt ID Q9GZX6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL22 Products

Required fields are marked with *

My Review for All IL22 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon