Recombinant Rat Il22 protein

Cat.No. : Il22-582R
Product Overview : Recombinant Rat Il22 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 146
Description : IL-22 is belonging to IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes and dendritic cells, IL-10 contributes to the inflammatory response in vivo. IL-22 signals through CRF2-4 and IL-22. It along with IL-17 is rapidly produced by splenic LTi-like cells and can be also produced by Th17 cells and likely plays a role in the coordinated response of both adaptive and innate immune systems. Recombinant rat Interleukin-22 contains 146 amino acids and it has approximately 79 % and 92 % amino acid sequence identity with human and murine IL-22.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by inducing IL-10 secretion of human COLO 205 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
Molecular Mass : Approximately16.6 kDa, a single non-glycosylated polypeptide chain containing 146 amino acids.
AA Sequence : LPINSQCKLEAANFQQPYIVNRTFMLAKEASLADNNTDVRLIGEELFRGVKAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSIHLSPCHISGDDQNIQKNVRQLKETVQKLGESGEIKAIGELDLLFMSLRNACV
Endotoxin : Less than 1 EU/μg of rRtIL-22 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Il22
Official Symbol Il22
Synonyms Cytokine Zcyto 18, TIF
Gene ID 500836
mRNA Refseq NM_001191988
Protein Refseq NP_001178917
UniProt ID Q198B4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il22 Products

Required fields are marked with *

My Review for All Il22 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon