Recombinant Rat Il22 protein
Cat.No. : | Il22-582R |
Product Overview : | Recombinant Rat Il22 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 146 |
Description : | IL-22 is belonging to IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes and dendritic cells, IL-10 contributes to the inflammatory response in vivo. IL-22 signals through CRF2-4 and IL-22. It along with IL-17 is rapidly produced by splenic LTi-like cells and can be also produced by Th17 cells and likely plays a role in the coordinated response of both adaptive and innate immune systems. Recombinant rat Interleukin-22 contains 146 amino acids and it has approximately 79 % and 92 % amino acid sequence identity with human and murine IL-22. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by inducing IL-10 secretion of human COLO 205 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg. |
Molecular Mass : | Approximately16.6 kDa, a single non-glycosylated polypeptide chain containing 146 amino acids. |
AA Sequence : | LPINSQCKLEAANFQQPYIVNRTFMLAKEASLADNNTDVRLIGEELFRGVKAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSIHLSPCHISGDDQNIQKNVRQLKETVQKLGESGEIKAIGELDLLFMSLRNACV |
Endotoxin : | Less than 1 EU/μg of rRtIL-22 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il22 |
Official Symbol | Il22 |
Synonyms | Cytokine Zcyto 18, TIF |
Gene ID | 500836 |
mRNA Refseq | NM_001191988 |
Protein Refseq | NP_001178917 |
UniProt ID | Q198B4 |
◆ Recombinant Proteins | ||
IL22-60Z | Recombinant Zebrafish IL22 Protein, His-tagged | +Inquiry |
IL22-637H | Recombinant Human Interleukin 22, HQ-tagged | +Inquiry |
IL22-461H | Active Recombinant Human IL22 protein | +Inquiry |
Il22-01M | Active Recombinant Mouse Il22 Protein, His-Tagged | +Inquiry |
IL22-360I | Active Recombinant Human IL22 Protein (147 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL22-5232HCL | Recombinant Human IL22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il22 Products
Required fields are marked with *
My Review for All Il22 Products
Required fields are marked with *
0
Inquiry Basket