Active Recombinant Human IL22 Protein, His-tagged

Cat.No. : IL22-002H
Product Overview : Recombinant human IL22 protein(34-179aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 34-179 a.a.
Description : IL22, also known as interleukin-22, is a member of a group of cytokines involved the IL-10 family or IL-10 subfamily. This protein shares us of IL-10R2 in cell signaling with other members of this family, IL-10, IL-26, IL-28A/B and IL-29. It is produced by normal T cells upon anti-CD3 stimulation and initiates innate immune responses against bacterial pathogens especially in epithelial cells such as respiratory and gut epithelial cells. Also, it can be produced by Th17 cells and play a role in the coordinated response of both adaptive and innate immune systems. Biological activity of IL-22 is the functional receptor complex consists of two receptor subunits, IL-22R and IL-10R and is further regulated by interactions with a soluble binding protein, IL-22BP, which shares sequence similarity with an extracellular region of IL-22R1.
Form : Liquid
Bio-activity : Measured by its ability to induce IL-10 secretion using COLO 205 human colorectal adenocarcinoma cell. The ED50 for this effects is less or equal to 1.2 ng/mL.
Molecular Mass : 17.8 kDa (155aa)
AA Sequence : ADPAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACIHHHHHH
N-terminal Sequence Analysis : Ala
Endotoxin : < 0.1 EU per 1μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterin.
Storage : Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 or -70 centigrade.
Avoid repeated freezing and thawing cycles.
Concentration : 1.0 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Gene Name IL22 interleukin 22 [ Homo sapiens (human) ]
Official Symbol IL22
Synonyms IL22; IL-21; IL-22; IL-D110; IL-TIF; ILTIF; TIFa; TIFIL-23; zcyto18; Interleukin-22; interleukin-22; IL-10-related T-cell-derived inducible factor; cytokine Zcyto18
Gene ID 50616
mRNA Refseq NM_020525
Protein Refseq NP_065386
MIM 605330
UniProt ID Q9GZX6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL22 Products

Required fields are marked with *

My Review for All IL22 Products

Required fields are marked with *

0
cart-icon
0
compare icon