Active Recombinant Human IL22 Protein, His-tagged
Cat.No. : | IL22-002H |
Product Overview : | Recombinant human IL22 protein(34-179aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 34-179 a.a. |
Description : | IL22, also known as interleukin-22, is a member of a group of cytokines involved the IL-10 family or IL-10 subfamily. This protein shares us of IL-10R2 in cell signaling with other members of this family, IL-10, IL-26, IL-28A/B and IL-29. It is produced by normal T cells upon anti-CD3 stimulation and initiates innate immune responses against bacterial pathogens especially in epithelial cells such as respiratory and gut epithelial cells. Also, it can be produced by Th17 cells and play a role in the coordinated response of both adaptive and innate immune systems. Biological activity of IL-22 is the functional receptor complex consists of two receptor subunits, IL-22R and IL-10R and is further regulated by interactions with a soluble binding protein, IL-22BP, which shares sequence similarity with an extracellular region of IL-22R1. |
Form : | Liquid |
Bio-activity : | Measured by its ability to induce IL-10 secretion using COLO 205 human colorectal adenocarcinoma cell. The ED50 for this effects is less or equal to 1.2 ng/mL. |
Molecular Mass : | 17.8 kDa (155aa) |
AA Sequence : | ADPAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACIHHHHHH |
N-terminal Sequence Analysis : | Ala |
Endotoxin : | < 0.1 EU per 1μg of protein (determined by LAL method) |
Purity : | > 90% by SDS-PAGE |
Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterin. |
Storage : | Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 or -70 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1.0 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol. |
Gene Name | IL22 interleukin 22 [ Homo sapiens (human) ] |
Official Symbol | IL22 |
Synonyms | IL22; IL-21; IL-22; IL-D110; IL-TIF; ILTIF; TIFa; TIFIL-23; zcyto18; Interleukin-22; interleukin-22; IL-10-related T-cell-derived inducible factor; cytokine Zcyto18 |
Gene ID | 50616 |
mRNA Refseq | NM_020525 |
Protein Refseq | NP_065386 |
MIM | 605330 |
UniProt ID | Q9GZX6 |
◆ Recombinant Proteins | ||
IL22-002H | Active Recombinant Human IL22 Protein, His-tagged | +Inquiry |
IL22-098I | Active Recombinant Human IL22 Protein (146 aa) | +Inquiry |
IL22-561H | Active Recombinant Human IL22, MIgG2a Fc-tagged | +Inquiry |
IL22-2743H | Recombinant Human IL22 protein, His-tagged | +Inquiry |
IL22-163H | Recombinant Human IL22 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL22-5232HCL | Recombinant Human IL22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL22 Products
Required fields are marked with *
My Review for All IL22 Products
Required fields are marked with *
0
Inquiry Basket