Active Recombinant Human PDGFCC Protein
Cat.No. : | PDGFC-167P |
Product Overview : | Recombinant Human PDGFCC Protein without tag was expressed in HEK 293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Description : | Platelet-Derived Growth Factor (PDGF) is a potent mitogen for a wide range of cell types including fibroblasts, smooth muscle, connective tissue, bone and cartilage cells, and some blood cells. The PDGF is involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. The PDGF family consists of proteins derived from four genes (PDGF -A, -B, -C, and -D) that form four disulfide-linked homodimers (PDGF-AA, -BB, -CC, and -DD) and one heterodimer (PDGF-AB). |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 1 ng/mL, measured in a cell proliferation assay using 3T3 cells. |
Molecular Mass : | 15~19 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Human Platelet-derived growth factor (PDGF) -CC remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Platelet-derived growth factor (PDGF) -CC should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | PDGFC platelet derived growth factor C [ Homo sapiens ] |
Official Symbol | PDGFC |
Synonyms | PDGFC; platelet derived growth factor C; platelet-derived growth factor C; fallotein; SCDGF; PDGF-C; VEGF-E; spinal cord-derived growth factor; secretory growth factor-like protein; FALLOTEIN; |
Gene ID | 56034 |
mRNA Refseq | NM_016205 |
Protein Refseq | NP_057289 |
MIM | 608452 |
UniProt ID | Q9NRA1 |
◆ Recombinant Proteins | ||
Pdgfc-8158M | Recombinant Mouse Pdgfc protein, His & T7-tagged | +Inquiry |
PDGFC-699H | Active Recombinant Human PDGFC Protein, Met & His-tagged | +Inquiry |
PDGFC-7280H | Recombinant Human PDGFC protein, His-tagged | +Inquiry |
PDGFC-5000H | Recombinant Human PDGFC Protein (Val235-Gly345), N-His tagged | +Inquiry |
Pdgfc-873M | Active Recombinant Mouse Pdgfc protein(Val235-Gly345), hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFC-429HCL | Recombinant Human PDGFC cell lysate | +Inquiry |
PDGFC-2872HCL | Recombinant Human PDGFC cell lysate | +Inquiry |
PDGFC-1836MCL | Recombinant Mouse PDGFC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFC Products
Required fields are marked with *
My Review for All PDGFC Products
Required fields are marked with *
0
Inquiry Basket