Active Recombinant Human PDGFCC Protein

• Cat.No.: PDGFC-167P
• Product Overview: Recombinant Human PDGFCC Protein without tag was expressed in HEK 293.

Specification

• Species: Human
• Source: HEK293
• Description: Platelet-Derived Growth Factor (PDGF) is a potent mitogen for a wide range of cell types including fibroblasts, smooth muscle, connective tissue, bone and cartilage cells, and some blood cells. The PDGF is involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. The PDGF family consists of proteins derived from four genes (PDGF -A, -B, -C, and -D) that form four disulfide-linked homodimers (PDGF-AA, -BB, -CC, and -DD) and one heterodimer (PDGF-AB).
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 1 ng/mL, measured in a cell proliferation assay using 3T3 cells.
• Molecular Mass: 15~19 kDa, observed by reducing SDS-PAGE.
• AA Sequence: VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Human Platelet-derived growth factor (PDGF) -CC remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Platelet-derived growth factor (PDGF) -CC should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: PDGFC platelet derived growth factor C [ Homo sapiens ]
• Official Symbol: PDGFC
• Synonyms: PDGFC; platelet derived growth factor C; platelet-derived growth factor C; fallotein; SCDGF; PDGF-C; VEGF-E; spinal cord-derived growth factor; secretory growth factor-like protein; FALLOTEIN
• Gene ID: 56034
• mRNA Refseq: NM_016205
• Protein Refseq: NP_057289
• MIM: 608452
• UniProt ID: Q9NRA1