Active Recombinant Human ST2 Protein
Cat.No. : | IL1RL1-1009H |
Product Overview : | Recombinant Human ST2 also known as interleukin-1receptor-like 1 antigen is produced by mammalian expression system and the target gene encoding Lys19- Phe328 is expressed with a 6His tag at the C-terminus. Predicted molecular weight: 60 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | His |
Description : | ST2 is an interleukin-1 family receptor expressed in the heart. ST2 protein has two isoforms: a soluble (sST2) and membrane- bound form. Patients with heart failure and elevated ST2 protein levels in the blood are at risk for heart failure progression. |
Form : | Lyophilized |
Bio-activity : | Anti-h ST2 10201: + Anti-h ST2 10202: + Anti-h ST2 10203: + Anti-h ST2 10204: + Anti-h ST2 10205: + Anti-h ST2 10206: + Anti-h ST2 10207: + |
Molecular Mass : | 60kDa |
AA Sequence : | KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSG IYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWF KNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPV IGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSN GLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPSKECFVDHHHHHH |
Purity : | >90% by SDS-PAGE |
Storage : | -20centigrade |
Concentration : | 0.5 mg/ml when reconstituted with 100 µl of deionized wate |
Storage Buffer : | 20 mM Na-phosphate, pH 7.4, 150 mM NaCl |
Reconstitution : | Reconstitute lyophilized protein with 100 µl of deionized water |
Gene Name | IL1RL1 interleukin 1 receptor-like 1 [ Homo sapiens ] |
Official Symbol | IL1RL1 |
Synonyms | IL1RL1; interleukin 1 receptor-like 1; interleukin-1 receptor-like 1; DER4; FIT 1; homolog of mouse growth stimulation expressed; IL33R; ST2; ST2L; ST2V; T1; growth stimulation-expressed; interleukin 1 receptor-related protein; homolog of mouse growth stimulation-expressed; FIT-1; MGC32623; |
Gene ID | 9173 |
mRNA Refseq | NM_003856 |
Protein Refseq | NP_003847 |
MIM | 601203 |
UniProt ID | Q01638 |
◆ Recombinant Proteins | ||
IL1RL1-537H | Recombinant Human IL1RL1 Protein, DDK-tagged | +Inquiry |
IL1RL1-195H | Recombinant Human IL1RL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL1RL1-505H | Active Recombinant Mouse IL1RL1, HIgG1 Fc-tagged | +Inquiry |
IL1RL1-396H | Recombinant Human Interleukin 1 Receptor-Like 1, His-tagged | +Inquiry |
IL1RL1-502H | Active Recombinant Human IL1RL1, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1RL1-001MCL | Recombinant Mouse IL1RL1 cell lysate | +Inquiry |
IL1RL1-2481HCL | Recombinant Human IL1RL1 cell lysate | +Inquiry |
IL1RL1-1883HCL | Recombinant Human IL1RL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1RL1 Products
Required fields are marked with *
My Review for All IL1RL1 Products
Required fields are marked with *
0
Inquiry Basket