Active Recombinant Mouse Ccl5 Protein
Cat.No. : | Ccl5-2039M |
Product Overview : | Purified recombinant protein of Mouse chemokine (C-C motif) ligand 5 (Ccl5) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells. |
Bio-activity : | Determined by its ability to chemoattract total human lymphocyte population and total murine T cell population using a concentration range of 1.0-10.0 ng/mL. |
Molecular Mass : | 7.8 kDa |
AA Sequence : | SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
Gene Name | Ccl5 chemokine (C-C motif) ligand 5 [ Mus musculus (house mouse) ] |
Official Symbol | Ccl5 |
Synonyms | Ccl5; chemokine (C-C motif) ligand 5; S; RA; Scy; MuRa; SISd; Scya5; TCP22; RANTES; TCP228; MuRantes; C-C motif chemokine 5; SIS-delta; T-cell-specific protein RANTES; small-inducible cytokine A5 |
Gene ID | 20304 |
mRNA Refseq | NM_013653 |
Protein Refseq | NP_038681 |
UniProt ID | P30882 |
◆ Recombinant Proteins | ||
CCL5-151H | Recombinant Human CCL5 Protein, His-tagged | +Inquiry |
Ccl5-259M | Active Recombinant Mouse Chemokine (C-C motif) Ligand 5 | +Inquiry |
CCL5-1464H | Recombinant Human CCL5 Protein (Ser24-Ser91), N-GST tagged | +Inquiry |
CCL5-27H | Active Recombinant Human CCL5 Protein | +Inquiry |
CCL5-773H | Recombinant Human CCL5 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL5-2706HCL | Recombinant Human CCL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ccl5 Products
Required fields are marked with *
My Review for All Ccl5 Products
Required fields are marked with *
0
Inquiry Basket