Recombinant Human CCL5 Protein

Cat.No. : CCL5-43H
Product Overview : Recombinant Human CCL5 Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 67 amino acid
Description : Human CCL5, also known as Regulated upon Activation, Normal T cell Expressed and presumably Secreted (RANTES), attracts and activates leukocytes and plays a primary role in the inflammatory immune response. CCL5 activates several G protein-coupled receptors including CCRs 1, 3, 4, and 5. CCL5 binding to CCR5 inhibits the infectivity of M-tropic HIV-1 strains. Proteolytic removal of the two N-terminal residues by CD26 generates a CCL5 variant that functions as a more potent HIV-1 inhibitor and a CCR5 antagonist.
Form : Lyophilized
Molecular Mass : 7.84701 kDa
AA Sequence : SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQ VCANPEKKWVREYINSLEMS
Endotoxin : Endotoxin-free <0.01 EU/ug
Purity : Purity assessed by HPLC, Mass Spectrometry, and NMR
Storage : Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month.
tmpcolum67 : C-C motif chemokine ligand 5
Gene Name CCL5 C-C motif chemokine ligand 5 [ Homo sapiens (human) ]
Official Symbol CCL5
Synonyms SISd; eoCP; SCYA5; RANTES; TCP228; D17S136E; SIS-delta
Gene ID 6352
mRNA Refseq NM_002985
Protein Refseq NP_002976
MIM 187011
UniProt ID P13501

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL5 Products

Required fields are marked with *

My Review for All CCL5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon