Species : |
Human |
Source : |
E.coli |
Protein Length : |
68 |
Description : |
CCL5 or RANTES (acronym for Regulated upon Activation, Normal T cell Expressed and presumably Secreted), was initially discovered by subtractive hybridization as a transcript expressed in T cells but not B cells. Eosinophilchemotactic activities released by thrombinstimulated human platelets have also been purified and found to be identical to RANTES. Besides T cells and platelets, RANTES has been reported to be produced by renal tubular epithelium, synovial fibroblasts and selected tumor cells. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
Measured by its ability to chemoattract human CCR5 transfected BaF3 mouse pro-B cells.The ED50 for this effect is typically 1-5 ng/mL, corresponding to a Specific Activity of >2 × 10^5 IU/mg. |
Molecular Mass : |
7.8 kDa, a single non-glycosylated polypeptide chain containing 68 amino acids. |
AA Sequence : |
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
Endotoxin : |
Less than 1 EU/mg of rHuRANTES/CCL5 as determined by LAL method. |
Purity : |
>98% by SDS-PAGE and HPLC analyses. |
Storage : |
This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : |
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |